Reviewed
Homo Sapiens (Human) [TaxID: 9606]
Vif
Virion infectivity factor (Vif) (Q protein) (SOR protein)
Human Immunodeficiency Virus Type 2 Subtype A (isolate ROD) (HIV-2)
Viruses> Retro-transcribing Viruses> Retroviridae> Orthoretrovirinae> Lentivirus> Primate Lentivirus Group> Human Immunodeficiency Virus 2> HIV-2 Subtype A> Human Immunodeficiency Virus Type 2 Subtype A (isolate ROD) (HIV-2)
Various pathway(s) in which protein is involved
Not Available
Not Available
MEEDKRWIVVPTWRVPGRMEKWHSLVKYLKYKTKDLEKVCYVPHHKVGWAWWTCSRVIFPLKGNSHLEIQAYWNLTPEKGWLSSYSVRITWYTEKFWTDV
TPDCADVLIHSTYFPCFTAGEVRRAIRGEKLLSCCNYPRAHRAQVPSLQFLALVVVQQNDRPQRDSTTRKQRRRDYRRGLRLAKQDSRSHKQRSSESPTP
RTYFPGVAEVLEILA
TPDCADVLIHSTYFPCFTAGEVRRAIRGEKLLSCCNYPRAHRAQVPSLQFLALVVVQQNDRPQRDSTTRKQRRRDYRRGLRLAKQDSRSHKQRSSESPTP
RTYFPGVAEVLEILA
215
Not Available
Not Available
13-08-1987
Evidence at transcript level
| Amino Acid | Count | % Frequency | Amino Acid | Count | % Frequency |
|---|---|---|---|---|---|
| Alanine (A) | Leucine (L) | ||||
| Arginine (R) | Lysine (K) | ||||
| Asparagine (N) | Methionine (M) | ||||
| Aspartic Acid (D) | Phenylalanine (F) | ||||
| Cysteine (C) | Proline (P) | ||||
| Glutamine (Q) | Serine (S) | ||||
| Glutamic Acid (E) | Threonine (T) | ||||
| Glycine (G) | Tryptophan (W) | ||||
| Histidine (H) | Tyrosine (Y) | ||||
| Isoleucine (I) | Valine (V) |
| % Number of Residues in Helices | % Number of Residues in Strands | % Number of Residues in Coils |
|---|---|---|
Counteracts the innate antiviral activity of APOBEC3G. Forms a complex with host APOBEC3G thus preventing the entry of this lethally hypermutating enzyme into progeny virions. Functions as an adapter molecule, recruiting APOBEC3G to the ubiquitin-proteasome machinery. Targets APOBEC3G for degradation through the assembly with elongin BC complex, CUL5 and RBX1. Binds viral RNA and affects the stability of viral nucleoprotein core. May play a role in viral morphology (By similarity).
Not Available
♦ Host cytoplasm . Host cell membrane
♦ Peripheral membrane protein
♦ Cytoplasmic side . Virion . Note=In the cytoplasm, seems to colocalize with intermediate filament vimentin. A fraction is associated with the cytoplasmic side of cellular membranes, presumably via the interaction with Pr55Gag precursor (By similarity). .
♦ Peripheral membrane protein
♦ Cytoplasmic side . Virion . Note=In the cytoplasm, seems to colocalize with intermediate filament vimentin. A fraction is associated with the cytoplasmic side of cellular membranes, presumably via the interaction with Pr55Gag precursor (By similarity). .
Not Available
MOTIF 110 141 HCCH motif. ; MOTIF 147 156 BC-box-like motif.
Predicted/Modelled
Not Available
Not Available
Protein couldn't be modeled using I-Tasser and Raptor X because of length constraints of the software.
Not Available
- Million Molecules
Best 20 Hit molecules
Not Available