viHumans
Reviewed
Homo Sapiens (Human) [TaxID: 9606]
Gag
♦Gag polyprotein (Pr55Gag) [Cleaved into: Matrix protein p17 (MA)
♦ Capsid protein p24 (CA)
♦ Spacer peptide 1 (SP1) (p2)
♦ Nucleocapsid protein p7 (NC)
♦ Spacer peptide 2 (SP2) (p1)
♦ p6-gag]
Human Immunodeficiency Virus Type 1 Group M Subtype A (isolate MAL) (HIV-1)
Viruses> Retro-transcribing Viruses> Retroviridae> Orthoretrovirinae> Lentivirus> Primate Lentivirus Group> Human Immunodeficiency Virus 1> HIV-1 Unknown Group> Human Immunodeficiency Virus Type 1 Group M Subtype A (isolate MAL) (HIV-1)
Various pathway(s) in which protein is involved
Not Available
Not Available
MGARASVLSGGKLDAWEKIRLRPGGKKKYRLKHLVWASRELERFALNPGLLETGEGCQQIMEQLQSTLKTGSEEIKSLYNTVATLYCVHQRIDVKDTKEA
LDKIEEIQNKSRQKTQQAAAAQQAAAATKNSSSVSQNYPIVQNAQGQMIHQAISPRTLNAWVKVIEEKAFSPEVIPMFSALSEGATPQDLNMMLNIVGGH
QAAMQMLKDTINEEAADWDRVHPVHAGPIPPGQMREPRGSDIAGTTSTLQEQIGWMTSNPPIPVGDIYKRWIILGLNKIVRMYSPVSILDIRQGPKEPFR
DYVDRFFKTLRAEQATQEVKNWMTETLLVQNANPDCKTILKALGPGATLEEMMTACQGVGGPSHKARVLAEAMSQATNSTAAIMMQRGNFKGQKRIKCFN
CGKEGHLARNCRAPRKKGCWKCGKEGHQMKDCTERQANFLGKIWPSHKGRPGNFLQSRPEPTAPPAESFGFGEEIKPSQKQEQKDKELYPLASLKSLFGN
DQLSQ
505
Not Available
Not Available
23-01-2007
Inferred from homology
Amino Acid Count % Frequency Amino Acid Count % Frequency
Alanine (A) Leucine (L)
Arginine (R) Lysine (K)
Asparagine (N) Methionine (M)
Aspartic Acid (D) Phenylalanine (F)
Cysteine (C) Proline (P)
Glutamine (Q) Serine (S)
Glutamic Acid (E) Threonine (T)
Glycine (G) Tryptophan (W)
Histidine (H) Tyrosine (Y)
Isoleucine (I) Valine (V)
% Number of Residues in Helices % Number of Residues in Strands % Number of Residues in Coils
♦Gag polyprotein: Mediates, with Gag-Pol polyprotein, the essential events in virion assembly, including binding the plasma membrane, making the protein-protein interactions necessary to create spherical particles, recruiting the viral Env proteins, and packaging the genomic RNA via direct interactions with the RNA packaging sequence (Psi).
♦ Matrix protein p17: Targets the polyprotein to the plasma membrane via a multipartite membrane-binding signal, that includes its myristoylated N-terminus (By similarity). Matrix protein is part of the pre-integration complex. Implicated in the release from host cell mediated by Vpu. Binds to RNA (By similarity).
♦ Capsid protein p24: Forms the conical core that encapsulates the genomic RNA-nucleocapsid complex in the virion. Most core are conical, with only 7% tubular. The core is constituted by capsid protein hexamer subunits. The core is disassembled soon after virion entry (By similarity). Host restriction factors such as TRIM5-alpha or TRIMCyp bind retroviral capsids and cause premature capsid disassembly, leading to blocks in reverse transcription. Capsid restriction by TRIM5 is one of the factors which restricts HIV-1 to the human species. Host PIN1 apparently facilitates the virion uncoating (By similarity). On the other hand, interactions with PDZD8 or CYPA stabilize the capsid (By similarity).
♦ Nucleocapsid protein p7: Encapsulates and protects viral dimeric unspliced genomic RNA (gRNA). Binds these RNAs through its zinc fingers. Acts as a nucleic acid chaperone which is involved in rearangement of nucleic acid secondary structure during gRNA retrotranscription. Also facilitates template switch leading to recombination. As part of the polyprotein, participates in gRNA dimerization, packaging, tRNA incorporation and virion assembly.
♦ p6-gag: Plays a role in budding of the assembled particle by interacting with the host class E VPS proteins TSG101 and PDCD6IP/AIP1.
Not Available
GO:0003723  ;   GO:0005198  ;   GO:0008270  ;   GO:0019013  ;   GO:0020002  ;  
GO:0039702  ;   GO:0042025  ;   GO:0055036  ;   GO:0072494  
♦ Gag polyprotein: Host cell membrane
♦ Lipid-anchor . Host endosome, host multivesicular body . Note=These locations are probably linked to virus assembly sites. The main location is the cell membrane, but under some circumstances, late endosomal compartments can serve as productive sites for virion assembly. .
♦ Matrix protein p17: Virion membrane
♦ Lipid-anchor . Host nucleus . Host cytoplasm .
♦ Capsid protein p24: Virion .
♦ Nucleocapsid protein p7: Virion .
Not Available
MOTIF 16 22 Nuclear export signal. ; MOTIF 26 32 Nuclear localization signal. ; MOTIF 461 464 PTAP/PSAP motif.; MOTIF 488 497 LYPX(n)L motif.
Predicted/Modelled
Not Available
Not Available
Protein couldn't be modeled using I-Tasser and Raptor X because of length constraints of the software.
Not Available
Virtual screening has been performed using RASPD
  • Million Molecules

Best 20 Hit molecules

    Not Available