viHumans
Reviewed
Homo Sapiens (Human) [TaxID: 9606]
DBP[Gene ID: 1460850 ]
DNA-binding protein (DBP) (Early 2A protein) (Early E2A DNA-binding protein)
Human Adenovirus A Serotype 12 (HAdV-12) (Human Adenovirus 12)
Viruses> DsDNA Viruses> No RNA Stage> Adenoviridae> Mastadenovirus> Human Mastadenovirus A> Human Adenovirus A Serotype 12 (HAdV-12) (Human Adenovirus 12)
Various pathway(s) in which protein is involved
Not Available
MASNQHSQRERTPDRSAQPPPPKMGRYFLDSESEEELEAVPLPPKKKVKKSMAAIPLSPESAEEEEAEPPRAVLGVMGFSMPPVRIMHHADGSQSFQKME
TRQVHVLKASAQNSDENEKNVVVVRNPASQPLVSAWEKGMEAMAMLMEKYHVDHDERATFRFLPDQGSVYKKICTTWLNEEKRGLQLTFSSQKTFQELMG
RFLQGYMQAYAGVQQNSWEPTGCCVWEHKCTEREGELRCLHGMEMVRKEHLVEMDVTSESGQRALKENPSKAKVAQNRWGRNVVQIKNDDARCCFHDVGC
GNNSFSGKSCGLFYSEGMKAQIAFRQIEAFMLADYPHMRHGQKRLLMPVRCECLNKQDGLPRMGRQLCKITPFNLSNVDNIDINEVTDPGALASIKYPCL
LVFQCANPVYRNARGNAGPNCDFKISAPDVMGALQLVRQLWGENFDGSPPRLVIPEFKWHQRLQYRNISLPTNHGDCREEPFDF
484
Not Available
Not Available
13-08-1987
Inferred from homology
Amino Acid Count % Frequency Amino Acid Count % Frequency
Alanine (A) Leucine (L)
Arginine (R) Lysine (K)
Asparagine (N) Methionine (M)
Aspartic Acid (D) Phenylalanine (F)
Cysteine (C) Proline (P)
Glutamine (Q) Serine (S)
Glutamic Acid (E) Threonine (T)
Glycine (G) Tryptophan (W)
Histidine (H) Tyrosine (Y)
Isoleucine (I) Valine (V)
% Number of Residues in Helices % Number of Residues in Strands % Number of Residues in Coils
Plays a role in the elongation phase of viral strand displacement replication by unwinding the template in an ATP-independent fashion, employing its capacity to form multimers. Also enhances the rate of initiation. Released from template upon second strand synthesis. Assembles in complex with viral pTP, viral pol, host NFIA and host POU2F1/OCT1 on viral origin of replication. Covers the whole ssDNA genome during synthesis. The complementary strand synthesis induces its relese from DNA template. May inhibit cellular transcription mediated by the interaction between host SRCAP and CBP.
Not Available
GO:0003677  ;   GO:0006268  ;   GO:0006351  ;   GO:0008270  ;   GO:0019028  ;  
GO:0032508  ;   GO:0039687  ;   GO:0039693  ;   GO:0042025  
Host nucleus . Note=Accumulates in infected cells. .
Not Available
Not Available
Predicted/Modelled
Not Available
Not Available
Protein couldn't be modeled using I-Tasser and Raptor X because of length constraints of the software.
Not Available
Virtual screening has been performed using RASPD
  • Million Molecules

Best 20 Hit molecules

    Not Available