Reviewed
Homo Sapiens (Human) [TaxID: 9606]
Not Available
E1B 55 kDa protein (E1B-55K) (E1B protein, large T-antigen) (E1B-495R)
Human Adenovirus A Serotype 12 (HAdV-12) (Human Adenovirus 12)
Viruses> DsDNA Viruses> No RNA Stage> Adenoviridae> Mastadenovirus> Human Mastadenovirus A> Human Adenovirus A Serotype 12 (HAdV-12) (Human Adenovirus 12)
Various pathway(s) in which protein is involved
Not Available
Not Available
MEREIPPELGLHAGLHVNAAVEGMAEEEGLHLLAGAAFDHAAAADVARGEGGGAEPCGGGEVNMEQQVQEGHVLDSGEGPSCADDRDKQEKKESLKEAAV
LSRLTVNLMSRPRLETVYWQELQDEFQRGDMHLQYKYSFEQLKTHWLEPWEDMECAIKAFAKLALRPDCSYRITKTVTITSCAYIIGNGAIVEVDTSDRV
AFRCRMQGMGPGVVGLDGITFINVRFAGDKFKGIMFEANTCLVLHGVYFLNFSNICVESWNKVSARGCTFYGCWKGLVGRPKSKLSVKKCLFEKCVLALI
VEGDAHIRHNAASENACFVLLKGMAILKHNMVCGVSDQTMRRFVTCADGNCHTLKTVHIVSHSRHCWPVCDHNMFMRCTIHLGLRRGMFRPSQCNFSHSN
IMLEPEVFSRVCLNGVFDLSVELCKVIRYNDDTRHRCRQCECGSSHLELRPIVLNVTEELRSDHLTLSCLRTDYESSDEDDN
LSRLTVNLMSRPRLETVYWQELQDEFQRGDMHLQYKYSFEQLKTHWLEPWEDMECAIKAFAKLALRPDCSYRITKTVTITSCAYIIGNGAIVEVDTSDRV
AFRCRMQGMGPGVVGLDGITFINVRFAGDKFKGIMFEANTCLVLHGVYFLNFSNICVESWNKVSARGCTFYGCWKGLVGRPKSKLSVKKCLFEKCVLALI
VEGDAHIRHNAASENACFVLLKGMAILKHNMVCGVSDQTMRRFVTCADGNCHTLKTVHIVSHSRHCWPVCDHNMFMRCTIHLGLRRGMFRPSQCNFSHSN
IMLEPEVFSRVCLNGVFDLSVELCKVIRYNDDTRHRCRQCECGSSHLELRPIVLNVTEELRSDHLTLSCLRTDYESSDEDDN
482
Not Available
Not Available
13-08-1987
Inferred from homology
Amino Acid | Count | % Frequency | Amino Acid | Count | % Frequency |
---|---|---|---|---|---|
Alanine (A) | Leucine (L) | ||||
Arginine (R) | Lysine (K) | ||||
Asparagine (N) | Methionine (M) | ||||
Aspartic Acid (D) | Phenylalanine (F) | ||||
Cysteine (C) | Proline (P) | ||||
Glutamine (Q) | Serine (S) | ||||
Glutamic Acid (E) | Threonine (T) | ||||
Glycine (G) | Tryptophan (W) | ||||
Histidine (H) | Tyrosine (Y) | ||||
Isoleucine (I) | Valine (V) |
% Number of Residues in Helices | % Number of Residues in Strands | % Number of Residues in Coils |
---|---|---|
Plays a major role to prevent cellular inhibition of viral genome replication. Assembles an SCF-like E3 ubiquitin ligase complex based on the cellular proteins ELOB, ELOC, CUL5 and RBX1, in cooperation with viral E4orf6. This viral RING-type ligase ubiquitinates cellular substrates and targets them to proteasomal degradation: TP53/p53, LIG4, MRE11-RAD50-NBS1 (MRN) complex, ITGA3, DAXX and BLM. Degradation of host TP53/p53 activity is essential for preventing E1A-induced TP53 accumulation that would otherwise lead to cell apoptosis and growth arrest. E1B-55K also inactivates TP53 transcription-factor activity by binding its transactivation domain. E1B-55K also functions as a SUMO1 E3 ligase for TP53 which causes the latter to be sequestered in promyelocytic leukemia (PML) nuclear bodies thereby contributing to maximal inhibition of TP53 function.
Not Available
Host nucleus . Host cytoplasm . Note=Colocalizes with host TP53 to host PML nuclear bodies. PML localization of E1B-55K is necessary for E1B-55K-dependent SUMOylation of TP53. .
Not Available
Not Available
Predicted/Modelled
Not Available
Not Available
Protein couldn't be modeled using I-Tasser and Raptor X because of length constraints of the software.
Not Available
- Million Molecules
Best 20 Hit molecules
Not Available