viHumans
Reviewed
Cynomys Gunnisoni (Gunnison's Prairie Dog) [TaxID: 45479]; Cynomys Leucurus (White-tailed Prairie Dog) [TaxID: 99825]; Cynomys Ludovicianus (Black-tailed Prairie Dog) [TaxID: 45480]; Cynomys Mexicanus (Mexican Prairie Dog) [TaxID: 99826]; Cynomys Parvidens (Utah Prairie Dog) [TaxID: 99827]; Gliridae (dormice) [TaxID: 30650]; Heliosciurus Ruwenzorii (Ruwenzori Sun Squirrel) [TaxID: 226685]; Homo Sapiens (Human) [TaxID: 9606]; Mus Musculus (Mouse) [TaxID: 10090]
TK L2R[Gene ID: 928935 ]
Thymidine kinase (EC 2.7.1.21)
Monkeypox Virus (strain Zaire-96-I-16) (MPX)
Viruses> DsDNA Viruses> No RNA Stage> Poxviridae> Chordopoxvirinae> Orthopoxvirus> Monkeypox Virus> Monkeypox Virus (strain Zaire-96-I-16) (MPX)
Various pathway(s) in which protein is involved
Not Available
MNGGHIQLIIGPMLSGKSTELIRRVRRYQIAQYKCVTIKYSNDNRYGTGLWTHDKNNFAALEVTKLCDVLEAITDFSVIGIDEGQFFPDIVEFCERMANE
GKIVIVAALDGTFQRRPFNNILNLIPLSEMVVKLTAVCMKCFKEASFSKRLGAETEIEIIGGNDMYQSVCRKCYIDS
177
Not Available
Not Available
02-08-2002
Inferred from homology
Amino Acid Count % Frequency Amino Acid Count % Frequency
Alanine (A) Leucine (L)
Arginine (R) Lysine (K)
Asparagine (N) Methionine (M)
Aspartic Acid (D) Phenylalanine (F)
Cysteine (C) Proline (P)
Glutamine (Q) Serine (S)
Glutamic Acid (E) Threonine (T)
Glycine (G) Tryptophan (W)
Histidine (H) Tyrosine (Y)
Isoleucine (I) Valine (V)
% Number of Residues in Helices % Number of Residues in Strands % Number of Residues in Coils
Not Available
2.7.1.21  
GO:0004797  ;   GO:0005524  ;   GO:0046872  ;   GO:0071897  
Not Available
Not Available
Not Available
Predicted/Modelled
Not Available
ACT_SITE 83 83 Proton acceptor.
Protein couldn't be modeled using I-Tasser and Raptor X because of length constraints of the software.
Not Available
Virtual screening has been performed using RASPD
  • Million Molecules

Best 20 Hit molecules

    Not Available