Reviewed
Homo Sapiens (Human) [TaxID: 9606]
Not Available
Outer capsid glycoprotein VP7
Rotavirus A (isolate RVA/Human/Australia/Hu5/1977/G2P[X]) (RV-A) (Rotavirus A (isolate Hu/5))
Viruses> DsRNA Viruses> Reoviridae> Sedoreovirinae> Rotavirus> Rotavirus A> Rotavirus G2> Rotavirus A (isolate RVA/Human/Australia/Hu5/1977/G2P[X]) (RV-A) (Rotavirus A (isolate Hu/5))
NC_011500.2 ; NC_011501.2 ; NC_011502.2 ; NC_011503.2 ; NC_011504.2 ; NC_011505.2 ; NC_011506.2 ;
NC_011507.2 ; NC_011508.2 ; NC_011509.2 ; NC_011510.2 ; NC_011511.2
NC_011507.2 ; NC_011508.2 ; NC_011509.2 ; NC_011510.2 ; NC_011511.2
Various pathway(s) in which protein is involved
Not Available
Not Available
MYGIEYTTILTILISIILLNYILKTITNTMDYIIFRFLLLIALISPFVRTQNYGMYLPITGSLDAVYTNSTSGEPFLTSTLCLYYPAEAKNEISDDEWEN
TLSQLFLTKGWPIGSVYFKDYNDINTFSVNPQLYCDYNVVLMRYDNTSELDASELADLILNEWLCNPMDISLYYYQQSSESNKWISMGTDCTVKVCPLNT
QTLGIGCKTTDVNTFEIVASSEKLVITDVVNGVNHNINISINTCTIRNCNKLGPRENVAIIQVGGPNALDITADPTTVPQVQRIMRINWKKWWQVFYTVV
DYINQVIQVMSKRSRSLDAAAFYYRI
TLSQLFLTKGWPIGSVYFKDYNDINTFSVNPQLYCDYNVVLMRYDNTSELDASELADLILNEWLCNPMDISLYYYQQSSESNKWISMGTDCTVKVCPLNT
QTLGIGCKTTDVNTFEIVASSEKLVITDVVNGVNHNINISINTCTIRNCNKLGPRENVAIIQVGGPNALDITADPTTVPQVQRIMRINWKKWWQVFYTVV
DYINQVIQVMSKRSRSLDAAAFYYRI
326
VAR_SEQ 1 29 Missing (in isoform 2)
Not Available
20-03-1987
Evidence at transcript level
Amino Acid | Count | % Frequency | Amino Acid | Count | % Frequency |
---|---|---|---|---|---|
Alanine (A) | Leucine (L) | ||||
Arginine (R) | Lysine (K) | ||||
Asparagine (N) | Methionine (M) | ||||
Aspartic Acid (D) | Phenylalanine (F) | ||||
Cysteine (C) | Proline (P) | ||||
Glutamine (Q) | Serine (S) | ||||
Glutamic Acid (E) | Threonine (T) | ||||
Glycine (G) | Tryptophan (W) | ||||
Histidine (H) | Tyrosine (Y) | ||||
Isoleucine (I) | Valine (V) |
% Number of Residues in Helices | % Number of Residues in Strands | % Number of Residues in Coils |
---|---|---|
Outer capsid protein involved in attachment and possibly entry into the host epithelial cell. It is subsequently lost, together with VP4, following virus entry into the host cell. The outer layer contains 780 copies of VP7, grouped as 260 trimers. Rotavirus attachment and entry into the host cell probably involves multiple sequential contacts between the outer capsid proteins VP4 and VP7, and the cell receptors. In integrin-dependent strains, VP7 seems to essentially target the integrin heterodimers ITGAX/ITGB2 and ITGA5/ITGB3 at a postbinding stage, once the initial attachment by VP4 has been achieved (By similarity).
Not Available
♦ Virion . Host endoplasmic reticulum lumen . Note=Immature double-layered particles assembled in the cytoplasm bud across the membrane of the endoplasmic reticulum, acquiring during this process a transient lipid membrane that is modified with the ER resident viral glycoproteins NSP4 and VP7
♦ these enveloped particles also contain VP4. As the particles move towards the interior of the ER cisternae, the transient lipid membrane and the non-structural protein NSP4 are lost, while the virus surface proteins VP4 and VP7 rearrange to form the outermost virus protein layer, yielding mature infectious triple-layered particles (By similarity). .
♦ these enveloped particles also contain VP4. As the particles move towards the interior of the ER cisternae, the transient lipid membrane and the non-structural protein NSP4 are lost, while the virus surface proteins VP4 and VP7 rearrange to form the outermost virus protein layer, yielding mature infectious triple-layered particles (By similarity). .
Not Available
Not Available
Predicted/Modelled
Not Available
Not Available
Protein couldn't be modeled using I-Tasser and Raptor X because of length constraints of the software.
Not Available
- Million Molecules
Best 20 Hit molecules
Not Available