viHumans
Reviewed
Homo Sapiens (Human) [TaxID: 9606]
TRM3 UL15[Gene ID: 2703385 ]
Tripartite terminase subunit 3 (EC 3.1.-.-) (Terminase large subunit)
Human Herpesvirus 1 (strain 17) (HHV-1) (Human Herpes Simplex Virus 1)
Viruses> DsDNA Viruses> No RNA Stage> Herpesvirales> Herpesviridae> Alphaherpesvirinae> Simplexvirus> Human Herpesvirus 1 (HHV-1) (Human Herpes Simplex Virus 1)> Human Herpesvirus 1 (strain 17) (HHV-1) (Human Herpes Simplex Virus 1)
Not Available
Various pathway(s) in which protein is involved
Not Available
MFGQQLASDVQQYLERLEKQRQLKVGADEASAGLTMGGDALRVPFLDFATATPKRHQTVVPGVGTLHDCCEHSPLFSAVARRLLFNSLVPAQLKGRDFGG
DHTAKLEFLAPELVRAVARLRFKECAPADVVPQRNAYYSVLNTFQALHRSEAFRQLVHFVRDFAQLLKTSFRASSLTETTGPPKKRAKVDVATHGRTYGT
LELFQKMILMHATYFLAAVLLGDHAEQVNTFLRLVFEIPLFSDAAVRHFRQRATVFLVPRRHGKTWFLVPLIALSLASFRGIKIGYTAHIRKATEPVFEE
IDACLRGWFGSARVDHVKGETISFSFPDGSRSTIVFASSHNTNGIRGQDFNLLFVDEANFIRPDAVQTIMGFLNQANCKIIFVSSTNTGKASTSFLYNLR
GAADELLNVVTYICDDHMPRVVTHTNATACSCYILNKPVFITMDGAVRRTADLFLADSFMQEIIGGQARETGDDRPVLTKSAGERFLLYRPSTTTNSGLM
APDLYVYVDPAFTANTRASGTGVAVVGRYRDDYIIFALEHFFLRALTGSAPADIARCVVHSLTQVLALHPGAFRGVRVAVEGNSSQDSAVAIATHVHTEM
HRLLASEGADAGSGPELLFYHCEPPGSAVLYPFFLLNKQKTPAFEHFIKKFNSGGVMASQEIVSATVRLQTDPVEYLLEQLNNLTETVSPNTDVRTYSGK
RNGASDDLMVAVIMAIYLAAQAGPPHTFAPITRVS
735
Not Available
Not Available
01-07-1989
Evidence at protein level
Amino Acid Count % Frequency Amino Acid Count % Frequency
Alanine (A) Leucine (L)
Arginine (R) Lysine (K)
Asparagine (N) Methionine (M)
Aspartic Acid (D) Phenylalanine (F)
Cysteine (C) Proline (P)
Glutamine (Q) Serine (S)
Glutamic Acid (E) Threonine (T)
Glycine (G) Tryptophan (W)
Histidine (H) Tyrosine (Y)
Isoleucine (I) Valine (V)
% Number of Residues in Helices % Number of Residues in Strands % Number of Residues in Coils
Component of the molecular motor that translocates viral genomic DNA in empty capsid during DNA packaging. Forms a tripartite terminase complex together with TRM1 and TRM2 in the host cytoplasm. Once the complex reaches the host nucleus, it interacts with the capsid portal vertex. This portal forms a ring in which genomic DNA is translocated into the capsid. TRM3 carries an RNase H-like nuclease activity that plays an important role for the cleavage of concatemeric viral DNA into unit length genomes.
3.1.-.-  
GO:0003677  ;   GO:0006323  ;   GO:0016787  ;   GO:0042025  
Host nucleus , , . Note=Responsible for the nuclear localization of the two others subunits TRM1 and TRM2. , .
Not Available
MOTIF 183 189 Nuclear localization signal. ; MOTIF 258 265 Walker A motif. ; MOTIF 352 357 Walker B motif.
X-ray crystallography (2)
4IOX  5HUW  
♦ACT_SITE 357 357 For ATPase activity.
♦ ACT_SITE 509 509 For nuclease activity.
♦ ACT_SITE 581 581 For nuclease activity.
♦ ACT_SITE 707 707 For nuclease activity.
Protein couldn't be modeled using I-Tasser and Raptor X because of length constraints of the software.
Not Available
Virtual screening has been performed using RASPD
  • Million Molecules

Best 20 Hit molecules

    Not Available