viHumans
Reviewed
Homo Sapiens (Human) [TaxID: 9606]
UL14[Gene ID: 2703384 ]
Tegument protein UL14
Human Herpesvirus 1 (strain 17) (HHV-1) (Human Herpes Simplex Virus 1)
Viruses> DsDNA Viruses> No RNA Stage> Herpesvirales> Herpesviridae> Alphaherpesvirinae> Simplexvirus> Human Herpesvirus 1 (HHV-1) (Human Herpes Simplex Virus 1)> Human Herpesvirus 1 (strain 17) (HHV-1) (Human Herpes Simplex Virus 1)
Not Available
Various pathway(s) in which protein is involved
Not Available
MDRDAAHAALRRRLAETHLRAEIYKDQTLQLHREGVSTQDPRFVGAFMAAKAAHLELEARLKSRARLEMMRQRATCVKIRVEEQAARRDFLTAHRRYLDP
ALGERLDAVDDRLADQEEQLEEAATNASLWGDGDLAEGWMSPADSDLLVMWQLTSAPKVHANGPSRIGSHPTYTPTPTGPPGAPAAPLSRTPPSPAPPTG
PATDPASASGFARDYPDGE
219
Not Available
Not Available
15-08-2003
Evidence at protein level
Amino Acid Count % Frequency Amino Acid Count % Frequency
Alanine (A) Leucine (L)
Arginine (R) Lysine (K)
Asparagine (N) Methionine (M)
Aspartic Acid (D) Phenylalanine (F)
Cysteine (C) Proline (P)
Glutamine (Q) Serine (S)
Glutamic Acid (E) Threonine (T)
Glycine (G) Tryptophan (W)
Histidine (H) Tyrosine (Y)
Isoleucine (I) Valine (V)
% Number of Residues in Helices % Number of Residues in Strands % Number of Residues in Coils
Contributes to the nuclear transport of the viral transcriptional activator VP16 during the early phase of infection. Therefore, participates indirectly in the regulation of the immediate-early gene expression. Additionally, seems to be important for efficient nuclear targeting of capsids. The UL51-UL14 complex regulates final viral envelopment for efficient viral replication (PubMed:27440890).
Not Available
Virion tegument . Host cytoplasm . Host nucleus .
Not Available
Not Available
Predicted/Modelled
Not Available
Not Available
Protein couldn't be modeled using I-Tasser and Raptor X because of length constraints of the software.
Not Available
Virtual screening has been performed using RASPD
  • Million Molecules

Best 20 Hit molecules

    Not Available