viHumans
Reviewed
Homo Sapiens (Human) [TaxID: 9606]
UL13[Gene ID: 2703383 ]
Serine/threonine-protein kinase UL13 (EC 2.7.11.1) (Virion protein VMW57)
Human Herpesvirus 1 (strain 17) (HHV-1) (Human Herpes Simplex Virus 1)
Viruses> DsDNA Viruses> No RNA Stage> Herpesvirales> Herpesviridae> Alphaherpesvirinae> Simplexvirus> Human Herpesvirus 1 (HHV-1) (Human Herpes Simplex Virus 1)> Human Herpesvirus 1 (strain 17) (HHV-1) (Human Herpes Simplex Virus 1)
Not Available
Various pathway(s) in which protein is involved
Not Available
MDESRRQRPAGHVAANLSPQGARQRSFKDWLASYVHSNPHGASGRPSGPSLQDAAVSRSSHGSRHRSGLRERLRAGLSRWRMSRSSHRRASPETPGTAAK
LNRPPLRRSQAALTAPPSSPSHILTLTRIRKLCSPVFAINPALHYTTLEIPGARSFGGSGGYGDVQLIREHKLAVKTIKEKEWFAVELIATLLVGECVLR
AGRTHNIRGFIAPLGFSLQQRQIVFPAYDMDLGKYIGQLASLRTTNPSVSTALHQCFTELARAVVFLNTTCGISHLDIKCANILVMLRSDAVSLRRAVLA
DFSLVTLNSNSTIARGQFCLQEPDLKSPRMFGMPTALTTANFHTLVGHGYNQPPELLVKYLNNERAEFTNHRLKHDVGLAVDLYALGQTLLELVVSVYVA
PSLGVPVTRFPGYQYFNNQLSPDFALALLAYRCVLHPALFVNSAETNTHGLAYDVPEGIRRHLRNPKIRRAFTDRCINYQHTHKAILSSVALPPELKPLL
VLVSRLCHTNPCARHALS
518
Not Available
Not Available
20-03-1987
Evidence at protein level
Amino Acid Count % Frequency Amino Acid Count % Frequency
Alanine (A) Leucine (L)
Arginine (R) Lysine (K)
Asparagine (N) Methionine (M)
Aspartic Acid (D) Phenylalanine (F)
Cysteine (C) Proline (P)
Glutamine (Q) Serine (S)
Glutamic Acid (E) Threonine (T)
Glycine (G) Tryptophan (W)
Histidine (H) Tyrosine (Y)
Isoleucine (I) Valine (V)
% Number of Residues in Helices % Number of Residues in Strands % Number of Residues in Coils
Multifunctional serine/threonine kinase that plays a role in several processes including egress of virus particles from the nucleus, modulation of the actin cytoskeleton and regulation of viral and cellular gene expression. Regulates the nuclear localization of viral envelopment factors UL34 and UL31, by phosphorylating the US3 kinase, indicating a role in nuclear egress. Disrupts host nuclear lamins, including LMNA and LMNB1. Phosphorylates the viral Fc receptor composed of glycoproteins E (gE) and I (gI). Phosphorylation of glycoprotein E (gE) by UL13 alters its subcellular localization, from the host early endosome to the plasma membrane. Participates in the transcriptional regulation of cellular and viral mRNAs mainly by phosphorylating the viral transcriptional regulator ICP22. Additional substrates have been identified, including UL41, UL49 or host EF1D.
2.7.11.1  
GO:0004674  ;   GO:0005524  ;   GO:0016032  ;   GO:0019033  ;   GO:0042025  
Virion tegument . Host nucleus .
DOMAIN 151 518 Protein kinase.
Not Available
Predicted/Modelled
Not Available
ACT_SITE 277 277 Proton acceptor.
Protein couldn't be modeled using I-Tasser and Raptor X because of length constraints of the software.
Not Available
Virtual screening has been performed using RASPD
  • Million Molecules

Best 20 Hit molecules

    Not Available