Reviewed
Aedes [TaxID: 7158]; Bos Taurus (Bovine) [TaxID: 9913]; Canis Lupus Familiaris (Dog) (Canis Familiaris) [TaxID: 9615]; Culex [TaxID: 7174]; Culiseta [TaxID: 174825]; Equus Caballus (Horse) [TaxID: 9796]; Gallus Gallus (Chicken) [TaxID: 9031]; Homo Sapiens (Human) [TaxID: 9606]; Lepus Americanus (Snowshoe Hare) [TaxID: 48086]
N
Nucleoprotein (Nucleocapsid protein) (Protein N)
Bunyavirus Snowshoe Hare
Viruses> SsRNA Viruses> SsRNA Negative-strand Viruses> Bunyavirales> Peribunyaviridae> Orthobunyavirus> California Encephalitis Orthobunyavirus> Bunyavirus Snowshoe Hare
Various pathway(s) in which protein is involved
Not Available
Not Available
MSDLVFYDVASTGANGFDPDAGYMAFCVKYAESVNLAAVRIFFLNAAKAKAALSRKPERKANPKFGEWQVEVVNNHFPGNRNNPINSDDLTIHRLSGYLA
RWVLEQYKENEDESRRELIKTTIINPIAESNGVRWDSGAEIYLSFFPGTEMFLETFKFYPLTIGIYRVKQGMMDPQYLKKALRQRYGSLTADKWMSQKVT
AIAKSLKEVEQLKWGRGGLSDTARSFLQKFGIRLP
RWVLEQYKENEDESRRELIKTTIINPIAESNGVRWDSGAEIYLSFFPGTEMFLETFKFYPLTIGIYRVKQGMMDPQYLKKALRQRYGSLTADKWMSQKVT
AIAKSLKEVEQLKWGRGGLSDTARSFLQKFGIRLP
235
Not Available
Not Available
21-07-1986
Inferred from homology
Amino Acid | Count | % Frequency | Amino Acid | Count | % Frequency |
---|---|---|---|---|---|
Alanine (A) | Leucine (L) | ||||
Arginine (R) | Lysine (K) | ||||
Asparagine (N) | Methionine (M) | ||||
Aspartic Acid (D) | Phenylalanine (F) | ||||
Cysteine (C) | Proline (P) | ||||
Glutamine (Q) | Serine (S) | ||||
Glutamic Acid (E) | Threonine (T) | ||||
Glycine (G) | Tryptophan (W) | ||||
Histidine (H) | Tyrosine (Y) | ||||
Isoleucine (I) | Valine (V) |
% Number of Residues in Helices | % Number of Residues in Strands | % Number of Residues in Coils |
---|---|---|
Encapsidates the genome protecting it from nucleases. The encapsidated genomic RNA is termed the nucleocapsid (NC) and serves as template for transcription and replication. Seems to participate in the nuclear relocalization of host PABP1, thereby inhibiting host cellular translation (By similarity).
Not Available
Virion. Note=Internal protein of virus particle.
Not Available
Not Available
Predicted/Modelled
Not Available
Not Available
Protein couldn't be modeled using I-Tasser and Raptor X because of length constraints of the software.
Not Available
- Million Molecules
Best 20 Hit molecules
Not Available