Reviewed
Homo Sapiens (Human) [TaxID: 9606]
Tax[Gene ID: 1491946 ]
Protein Tax-2 (Trans-activating transcriptional regulatory protein of HTLV-2)
Human T-cell Leukemia Virus 2 (HTLV-2)
Viruses> Retro-transcribing Viruses> Retroviridae> Orthoretrovirinae> Deltaretrovirus> Primate T-lymphotropic Virus 2> Human T-cell Leukemia Virus 2 (HTLV-2)
Not Available
Various pathway(s) in which protein is involved
Not Available
MAHFPGFGQSLLYGYPVYVFGDCVQADWCPVSGGLCSTRLHRHALLATCPEHQLTWDPIDGRVVSSPLQYLIPRLPSFPTQRTSRTLKVLTPPTTPVSPK
VPPAFFQSMRKHTPYRNGCLEPTLGDQLPSLAFPEPGLRPQNIYTTWGKTVVCLYLYQLSPPMTWPLIPHVIFCHPRQLGAFLTKVPLKRLEELLYKMFL
HTGTVIVLPEDDLPTTMFQPVRAPCIQTAWCTGLLPYHSILTTPGLIWTFNDGSPMISGPYPKAGQPSLVVQSSLLIFEKFETKAFHPSYLLSHQLIQYS
SFHNLHLLFDEYTNIPVSILFNKEEADDNGD
VPPAFFQSMRKHTPYRNGCLEPTLGDQLPSLAFPEPGLRPQNIYTTWGKTVVCLYLYQLSPPMTWPLIPHVIFCHPRQLGAFLTKVPLKRLEELLYKMFL
HTGTVIVLPEDDLPTTMFQPVRAPCIQTAWCTGLLPYHSILTTPGLIWTFNDGSPMISGPYPKAGQPSLVVQSSLLIFEKFETKAFHPSYLLSHQLIQYS
SFHNLHLLFDEYTNIPVSILFNKEEADDNGD
331
Not Available
Not Available
16-05-2006
Evidence at protein level
| Amino Acid | Count | % Frequency | Amino Acid | Count | % Frequency |
|---|---|---|---|---|---|
| Alanine (A) | Leucine (L) | ||||
| Arginine (R) | Lysine (K) | ||||
| Asparagine (N) | Methionine (M) | ||||
| Aspartic Acid (D) | Phenylalanine (F) | ||||
| Cysteine (C) | Proline (P) | ||||
| Glutamine (Q) | Serine (S) | ||||
| Glutamic Acid (E) | Threonine (T) | ||||
| Glycine (G) | Tryptophan (W) | ||||
| Histidine (H) | Tyrosine (Y) | ||||
| Isoleucine (I) | Valine (V) |
| % Number of Residues in Helices | % Number of Residues in Strands | % Number of Residues in Coils |
|---|---|---|
Transcriptional activator that activates both the viral long terminal repeat (LTR) and cellular promoters via activation of CREB, NF-kappa-B, SRF and AP-1 pathways. Binds to three 21 bp repeat elements located within the LTRs, referred to as Tax-responsive elements (TRE). Binding to TRE requires the interaction with CREB1 and CREBBP. Induces T-cell transformation, although much less efficiently than HTLV-1. Required for viral replication (By similarity).
Not Available
GO:0003677 ; GO:0006351 ; GO:0016491 ; GO:0017124 ; GO:0030430 ;
GO:0039646 ; GO:0042025 ; GO:0045893 ; GO:0046872 ; GO:0051537
GO:0039646 ; GO:0042025 ; GO:0045893 ; GO:0046872 ; GO:0051537
Host cytoplasm . Host nucleus . Note=Tax-2 is mainly found in the cytoplasm.
Not Available
MOTIF 73 80 SH3-binding. ; MOTIF 188 202 Nuclear export signal.
Predicted/Modelled
Not Available
Not Available
Protein couldn't be modeled using I-Tasser and Raptor X because of length constraints of the software.
Not Available
- Million Molecules
Best 20 Hit molecules
Not Available