Reviewed
Homo Sapiens (Human) [TaxID: 9606]
L2[Gene ID: 2652996 ]
Core-capsid bridging protein (Core protein V)
Human Adenovirus C Serotype 2 (HAdV-2) (Human Adenovirus 2)
Viruses> DsDNA Viruses> No RNA Stage> Adenoviridae> Mastadenovirus> Human Mastadenovirus C> Human Adenovirus C Serotype 2 (HAdV-2) (Human Adenovirus 2)
Various pathway(s) in which protein is involved
Not Available
Not Available
MSKRKIKEEMLQVIAPEIYGPPKKEEQDYKPRKLKRVKKKKKDDDDDELDDEVELLHATAPRRRVQWKGRRVRRVLRPGTTVVFTPGERSTRTYKRVYDE
VYGDEDLLEQANERLGEFAYGKRHKDMLALPLDEGNPTPSLKPVTLQQVLPTLAPSEEKRGLKRESGDLAPTVQLMVPKRQRLEDVLEKMTVEPGLEPEV
RVRPIKQVAPGLGVQTVDVQIPTTSSTSIATATEGMETQTSPVASAVADAAVQAAAAAASKTSTEVQTDPWMFRVSAPRRPRRSRKYGTASALLPEYALH
PSIAPTPGYRGYTYRPRRRATTRRRTTTGTRRRRRRRQPVLAPISVRRVAREGGRTLVLPTARYHPSIV
VYGDEDLLEQANERLGEFAYGKRHKDMLALPLDEGNPTPSLKPVTLQQVLPTLAPSEEKRGLKRESGDLAPTVQLMVPKRQRLEDVLEKMTVEPGLEPEV
RVRPIKQVAPGLGVQTVDVQIPTTSSTSIATATEGMETQTSPVASAVADAAVQAAAAAASKTSTEVQTDPWMFRVSAPRRPRRSRKYGTASALLPEYALH
PSIAPTPGYRGYTYRPRRRATTRRRTTTGTRRRRRRRQPVLAPISVRRVAREGGRTLVLPTARYHPSIV
369
Not Available
Not Available
21-07-1986
Evidence at protein level
Amino Acid | Count | % Frequency | Amino Acid | Count | % Frequency |
---|---|---|---|---|---|
Alanine (A) | Leucine (L) | ||||
Arginine (R) | Lysine (K) | ||||
Asparagine (N) | Methionine (M) | ||||
Aspartic Acid (D) | Phenylalanine (F) | ||||
Cysteine (C) | Proline (P) | ||||
Glutamine (Q) | Serine (S) | ||||
Glutamic Acid (E) | Threonine (T) | ||||
Glycine (G) | Tryptophan (W) | ||||
Histidine (H) | Tyrosine (Y) | ||||
Isoleucine (I) | Valine (V) |
% Number of Residues in Helices | % Number of Residues in Strands | % Number of Residues in Coils |
---|---|---|
Associates loosely with the viral DNA to form an outer shell around the nucleoprotein-DNA complex and links it with the capsid by binding the endosome lysis protein. Dissociates from the viral genome during entry. Might be involved in nuclear capsid assembly of the viral particles through its association with NPM1/nucleophosmin.
Not Available
Virion . Host nucleus, host nucleolus , . Note=Located inside the capsid (core). Present in 157 copies per virion. Localizes in the nucleoli during infection, then translocates from the nucleoli to the nucleoplasm as the infection progresses and is finally incorporated into the viral particles. .
Not Available
Not Available
Predicted/Modelled
Not Available
Not Available
Protein couldn't be modeled using I-Tasser and Raptor X because of length constraints of the software.
Not Available
- Million Molecules
Best 20 Hit molecules
Not Available