Reviewed
Homo Sapiens (Human) [TaxID: 9606]
Not Available
Early E1A protein (Early E1A 29.5 kDa protein)
Human Adenovirus A Serotype 12 (HAdV-12) (Human Adenovirus 12)
Viruses> DsDNA Viruses> No RNA Stage> Adenoviridae> Mastadenovirus> Human Mastadenovirus A> Human Adenovirus A Serotype 12 (HAdV-12) (Human Adenovirus 12)
Various pathway(s) in which protein is involved
Not Available
MRTEMTPLVLSYQEADDILEHLVDNFFNEVPSDDDLYVPSLYELYDLDVESAGEDNNEQAVNEFFPESLILAASEGLFLPEPPVLSPVCEPIGGECMPQL
HPEDMDLLCYEMGFPCSDSEDEQDENGMAHVSASAAAAAADREREEFQLDHPELPGHNCKSCEHHRNSTGNTDLMCSLCYLRAYNMFIYSPVSDNEPEPN
STLDGDERPSPPKLGSAVPEGVIKPVPQRVTGRRRCAVESILDLIQEEEREQTVPVDLSVKRPRCN
HPEDMDLLCYEMGFPCSDSEDEQDENGMAHVSASAAAAAADREREEFQLDHPELPGHNCKSCEHHRNSTGNTDLMCSLCYLRAYNMFIYSPVSDNEPEPN
STLDGDERPSPPKLGSAVPEGVIKPVPQRVTGRRRCAVESILDLIQEEEREQTVPVDLSVKRPRCN
266
VAR_SEQ 31 244 Missing (in isoform Early E1A 6 kDa protein) ; VAR_SEQ 160 190 Missing (in isoform Early E1A 26 kDa protein) ; VAR_SEQ 191 234 Missing (in isoform Early E1A 22 kDa protein) ; VAR_SEQ 245 266 IQEEEREQTVPVDLSVKRPRCN -> FPIMSLNLIALWMAMSDPHPRN (in isoform Early E1A 6 kDa protein) ; VAR_SEQ 259 266 SVKRPRCN -> KCAMGGGR (in isoform Early E1A 22 kDa protein)
Not Available
21-07-1986
Evidence at protein level
Amino Acid | Count | % Frequency | Amino Acid | Count | % Frequency |
---|---|---|---|---|---|
Alanine (A) | Leucine (L) | ||||
Arginine (R) | Lysine (K) | ||||
Asparagine (N) | Methionine (M) | ||||
Aspartic Acid (D) | Phenylalanine (F) | ||||
Cysteine (C) | Proline (P) | ||||
Glutamine (Q) | Serine (S) | ||||
Glutamic Acid (E) | Threonine (T) | ||||
Glycine (G) | Tryptophan (W) | ||||
Histidine (H) | Tyrosine (Y) | ||||
Isoleucine (I) | Valine (V) |
% Number of Residues in Helices | % Number of Residues in Strands | % Number of Residues in Coils |
---|---|---|
Plays a role in viral genome replication by driving entry of quiescent cells into the cell cycle. Stimulation of progression from G1 to S phase allows the virus to efficiently use the cellular DNA replicating machinery to achieve viral genome replication. E1A protein has both transforming and trans-activating activities. Induces the disassembly of the E2F1 transcription factor from RB1 by direct competition for the same binding site on RB1, with subsequent transcriptional activation of E2F1-regulated S-phase genes and of the E2 region of the adenoviral genome. Release of E2F1 leads to the ARF-mediated inhibition of MDM2 and causes TP53/p53 to accumulate because it is not targeted for degradation by MDM2-mediated ubiquitination anymore. This increase in TP53, in turn, would arrest the cell proliferation and direct its death but this effect is counteracted by the viral protein E1B-55K. Inactivation of the ability of RB1 to arrest the cell cycle is critical for cellular transformation, uncontrolled cellular growth and proliferation induced by viral infection. Interaction with RBX1 and CUL1 inhibits ubiquitination of the proteins targeted by SCF(FBXW7) ubiquitin ligase complex, and may be linked to unregulated host cell proliferation. The tumorigenesis-restraining activity of E1A may be related to the disruption of the host CtBP-CtIP complex through the CtBP binding motif. Interaction with host TMEM173/STING impairs the ability of TMEM173/STING to sense cytosolic DNA and promote the production of type I interferon (IFN-alpha and IFN-beta).
Not Available
GO:0006351 ; GO:0006355 ; GO:0039502 ; GO:0039563 ; GO:0039644 ;
GO:0039645 ; GO:0039649 ; GO:0042025 ; GO:0046872
GO:0039645 ; GO:0039649 ; GO:0042025 ; GO:0046872
Host nucleus .
Not Available
MOTIF 98 102 PXLXP motif, interaction with host ZMYND11. ; MOTIF 107 111 LXCXE motif, interaction with host RB1 and TMEM173/STING. ; MOTIF 255 259 PXDLS motif, CTBP-binding. ; MOTIF 261 265 Nuclear localization signal.
Predicted/Modelled
Not Available
Not Available
Protein couldn't be modeled using I-Tasser and Raptor X because of length constraints of the software.
Not Available
- Million Molecules
Best 20 Hit molecules
Not Available