viHumans
Reviewed
Homo Sapiens (Human) [TaxID: 9606]
Not Available
Early 3 receptor internalization and degradation beta protein (E3 RID-beta protein) (Early E3B 14.5 kDa protein) (E3-14.5k)
Human Adenovirus C Serotype 2 (HAdV-2) (Human Adenovirus 2)
Viruses> DsDNA Viruses> No RNA Stage> Adenoviridae> Mastadenovirus> Human Mastadenovirus C> Human Adenovirus C Serotype 2 (HAdV-2) (Human Adenovirus 2)
AC_000007.1 ;   
Various pathway(s) in which protein is involved
Not Available
Not Available
MKRSVIFVLLIFCALPVLCSQTSAPPKRHISCRFTQIWNIPSCYNKQSDLSEAWLYAIISVMVFCSTIFALAIYPYLDIGWNAIDAMNHPTFPVPAVIPL
QQVIAPINQPRPPSPTPTEISYFNLTGGDD
130
Not Available
Not Available
21-07-1986
Evidence at protein level
Amino Acid Count % Frequency Amino Acid Count % Frequency
Alanine (A) Leucine (L)
Arginine (R) Lysine (K)
Asparagine (N) Methionine (M)
Aspartic Acid (D) Phenylalanine (F)
Cysteine (C) Proline (P)
Glutamine (Q) Serine (S)
Glutamic Acid (E) Threonine (T)
Glycine (G) Tryptophan (W)
Histidine (H) Tyrosine (Y)
Isoleucine (I) Valine (V)
% Number of Residues in Helices % Number of Residues in Strands % Number of Residues in Coils
Prevents infected cell apoptosis induced by the host immune system. Acts by down-regulating a number of cell surface receptors in the tumor necrosis factor (TNF) receptor superfamily, namely FAS, TNFRSF10A/TRAIL receptor 1, and TNFRSF10B/TRAIL receptor 2. Down-regulation of these death receptors protects adenovirus-infected cells from apoptosis induced by the death receptor ligands Fas ligand and TRAIL. RID complex also down-regulates certain tyrosine kinase cell surface receptors, especially the epidermal growth factor receptor (EGFR). RID-mediated Fas and EGFR down-regulation occurs via endocytosis of the receptors into endosomes followed by transport to and degradation within lysosomes.
Not Available
♦ Host membrane
♦ Single-pass type I membrane protein .
Not Available
Not Available
Predicted/Modelled
Not Available
Not Available
Protein couldn't be modeled using I-Tasser and Raptor X because of length constraints of the software.
Not Available
Virtual screening has been performed using RASPD
  • Million Molecules

Best 20 Hit molecules

    Not Available