Reviewed
Homo Sapiens (Human) [TaxID: 9606]
E1B[Gene ID: 2652981 ]
E1B protein, small T-antigen (E1B 19 kDa protein) (E1B-19K) (E1B-175R)
Human Adenovirus C Serotype 2 (HAdV-2) (Human Adenovirus 2)
Viruses> DsDNA Viruses> No RNA Stage> Adenoviridae> Mastadenovirus> Human Mastadenovirus C> Human Adenovirus C Serotype 2 (HAdV-2) (Human Adenovirus 2)
Various pathway(s) in which protein is involved
Not Available
MEAWECLEDFSAVRNLLEQSSNSTSWFWRFLWGSSQAKLVCRIKEDYKWEFEELLKSCGELFDSLNLGHQALFQEKVIKTLDFSTPGRAAAAVAFLSFIK
DKWSEETHLSGGYLLDFLAMHLWRAVVRHKNRLLLLSSVRPAIIPTEEQQQEEARRRRRQEQSPWNPRAGLDPRE
DKWSEETHLSGGYLLDFLAMHLWRAVVRHKNRLLLLSSVRPAIIPTEEQQQEEARRRRRQEQSPWNPRAGLDPRE
175
Not Available
Not Available
01-03-1992
Evidence at protein level
Amino Acid | Count | % Frequency | Amino Acid | Count | % Frequency |
---|---|---|---|---|---|
Alanine (A) | Leucine (L) | ||||
Arginine (R) | Lysine (K) | ||||
Asparagine (N) | Methionine (M) | ||||
Aspartic Acid (D) | Phenylalanine (F) | ||||
Cysteine (C) | Proline (P) | ||||
Glutamine (Q) | Serine (S) | ||||
Glutamic Acid (E) | Threonine (T) | ||||
Glycine (G) | Tryptophan (W) | ||||
Histidine (H) | Tyrosine (Y) | ||||
Isoleucine (I) | Valine (V) |
% Number of Residues in Helices | % Number of Residues in Strands | % Number of Residues in Coils |
---|---|---|
Putative adenovirus Bcl-2 homolog that inhibits apoptosis induced by TNF or FAS pathways, as well as p53-mediated apoptosis. Without E1B 19K function, virus production is compromised because of premature death of host cell. Interacts with Bax protein in cell lysates (By similarity).
Not Available
GO:0005521 ; GO:0016020 ; GO:0019050 ; GO:0020002 ; GO:0043066 ;
GO:0044165 ; GO:0044199 ; GO:0044203
GO:0044165 ; GO:0044199 ; GO:0044203
Host cell membrane . Host nucleus envelope . Host nucleus lamina . Note=Associated with the plasma and nuclear membranes, and with the insoluble nuclear lamina. .
Not Available
Not Available
Predicted/Modelled
Not Available
Not Available
Protein couldn't be modeled using I-Tasser and Raptor X because of length constraints of the software.
Not Available
- Million Molecules
Best 20 Hit molecules
Not Available