viHumans
Reviewed
Homo Sapiens (Human) [TaxID: 9606]
Not Available
Early 4 ORF6 protein (E4-ORF6) (Early 4 34 kDa protein) (E4-34k)
Human Adenovirus C Serotype 2 (HAdV-2) (Human Adenovirus 2)
Viruses> DsDNA Viruses> No RNA Stage> Adenoviridae> Mastadenovirus> Human Mastadenovirus C> Human Adenovirus C Serotype 2 (HAdV-2) (Human Adenovirus 2)
AC_000007.1 ;   
Various pathway(s) in which protein is involved
Not Available
Not Available
MTTSGVPFGMTLRPTRSRLSRRTPYSRDRLPPFETETRATILEDHPLLPECNTLTMHNVSYVRGLPCSVGFTLIQEWVVPWDMVLTREELVILRKCMHVC
LCCANIDIMTSMMIHGYESWALHCHCSSPGSLQCIAGGQVLASWFRMVVDGAMFNQRFIWYREVVNYNMPKEVMFMSSVFMRGRHLIYLRLWYDGHVGSV
VPAMSFGYSALHCGILNNIVVLCCSYCADLSEIRVRCCARRTRRLMLRAVRIIAEETTAMLYSCRTERRRQQFIRALLQHHRPILMHDYDSTPM
294
Not Available
Not Available
21-07-1986
Evidence at protein level
Amino Acid Count % Frequency Amino Acid Count % Frequency
Alanine (A) Leucine (L)
Arginine (R) Lysine (K)
Asparagine (N) Methionine (M)
Aspartic Acid (D) Phenylalanine (F)
Cysteine (C) Proline (P)
Glutamine (Q) Serine (S)
Glutamic Acid (E) Threonine (T)
Glycine (G) Tryptophan (W)
Histidine (H) Tyrosine (Y)
Isoleucine (I) Valine (V)
% Number of Residues in Helices % Number of Residues in Strands % Number of Residues in Coils
Plays a major role to prevent cellular inhibition of viral genome replication by nuclear bodies. Assembles an SCF-like E3 ubiquitin ligase complex based on the cellular proteins ELOB, ELOC, CUL5 and RBX1, in cooperation with viral E1B-55K. This viral RING-type ligase ubiquitinates cellular substrates prior to proteasomal degradation: p53/TP53, LIG4, MRE11-RAD50-NBS1 (MRN) complex, ITGA3, DAXX and BLM.
Not Available
GO:0030430  ;   GO:0039503  ;   GO:0039648  ;   GO:0042025  ;   GO:0046872  
Host nucleus. Host cytoplasm. Note=Colocalizes with host PML-associated nuclear bodies.
Not Available
MOTIF 239 255 Nuclear localization signal.
Predicted/Modelled
Not Available
Not Available
Protein couldn't be modeled using I-Tasser and Raptor X because of length constraints of the software.
Not Available
Virtual screening has been performed using RASPD
  • Million Molecules

Best 20 Hit molecules

    Not Available