Reviewed
Homo Sapiens (Human) [TaxID: 9606]
BGLF5[Gene ID: 3783773 ]
Shutoff alkaline exonuclease (SOX) (EC 3.1.-.-)
Epstein-Barr Virus (strain B95-8) (HHV-4) (Human Herpesvirus 4)
Viruses> DsDNA Viruses> No RNA Stage> Herpesvirales> Herpesviridae> Gammaherpesvirinae> Lymphocryptovirus> Epstein-Barr Virus (strain GD1) (HHV-4) (Human Herpesvirus 4)> Epstein-Barr Virus (strain B95-8) (HHV-4) (Human Herpesvirus 4)
Various pathway(s) in which protein is involved
Not Available
MADVDELEDPMEEMTSYTFARFLRSPETEAFVRNLDRPPQMPAMRFVYLYCLCKQIQEFSGETGFCDFVSSLVQENDSKDGPSLKSIYWGLQEATDEQRT
VLCSYVESMTRGQSENLMWDILRNGIISSSKLLSTIKNGPTKVFEPAPISTNHYFGGPVAFGLRCEDTVKDIVCKLICGDASANRQFGFMISPTDGIFGV
SLDLCVNVESQGDFILFTDRSCIYEIKCRFKYLFSKSEFDPIYPSYTALYKRPCKRSFIRFINSIARPTVEYVPDGRLPSEGDYLLTQDEAWNLKDVRKR
KLGPGHDLVADSLAANRGVESMLYVMTDPSENAGRIGIKDRVPVNIFINPRHNYFYQVLLQYKIVGDYVRHSGGGKPGRDCSPRVNIVTAFFRKRSPLDP
ATCTLGSDLLLDASVEIPVAVLVTPVVLPDSVIRKTLSTAAGSWKAYADNTFDTAPWVPSGLFADDESTP
VLCSYVESMTRGQSENLMWDILRNGIISSSKLLSTIKNGPTKVFEPAPISTNHYFGGPVAFGLRCEDTVKDIVCKLICGDASANRQFGFMISPTDGIFGV
SLDLCVNVESQGDFILFTDRSCIYEIKCRFKYLFSKSEFDPIYPSYTALYKRPCKRSFIRFINSIARPTVEYVPDGRLPSEGDYLLTQDEAWNLKDVRKR
KLGPGHDLVADSLAANRGVESMLYVMTDPSENAGRIGIKDRVPVNIFINPRHNYFYQVLLQYKIVGDYVRHSGGGKPGRDCSPRVNIVTAFFRKRSPLDP
ATCTLGSDLLLDASVEIPVAVLVTPVVLPDSVIRKTLSTAAGSWKAYADNTFDTAPWVPSGLFADDESTP
470
Not Available
Not Available
21-07-1986
Evidence at protein level
Amino Acid | Count | % Frequency | Amino Acid | Count | % Frequency |
---|---|---|---|---|---|
Alanine (A) | Leucine (L) | ||||
Arginine (R) | Lysine (K) | ||||
Asparagine (N) | Methionine (M) | ||||
Aspartic Acid (D) | Phenylalanine (F) | ||||
Cysteine (C) | Proline (P) | ||||
Glutamine (Q) | Serine (S) | ||||
Glutamic Acid (E) | Threonine (T) | ||||
Glycine (G) | Tryptophan (W) | ||||
Histidine (H) | Tyrosine (Y) | ||||
Isoleucine (I) | Valine (V) |
% Number of Residues in Helices | % Number of Residues in Strands | % Number of Residues in Coils |
---|---|---|
Plays a role in processing non linear or branched viral DNA intermediates in order to promote the production of mature packaged unit-length linear progeny viral DNA molecules. Exhibits endonuclease and exonuclease activities and accepts both double-stranded and single-stranded DNA as substrate. Exonuclease digestion of DNA is in the 5'-> 3' direction and the products are 5'-monophosphate nucleosides. Additionally, forms a recombinase with the major DNA-binding protein, which displays strand exchange activity. Also acts as a cytoplasmic RNA endonuclease that induces degradation of the majority of the cellular messenger RNAs during early lytic infection. The resulting inhibition of cellular protein synthesis serves to ensure maximal viral gene expression and evasion from host immune response. Internally cleaves host mRNAs which are then degraded by the cellular exonuclease XRN1. Bypasses therefore the regulatory steps of deadenylation and decapping normally required for XRN1 activation.
3.1.-.-
GO:0003677 ; GO:0003723 ; GO:0004519 ; GO:0004527 ; GO:0030430 ;
GO:0039595 ; GO:0039657 ; GO:0042025
GO:0039595 ; GO:0039657 ; GO:0042025
Host nucleus . Host cytoplasm .
Not Available
Not Available
X-ray crystallography (2)
Not Available
Protein couldn't be modeled using I-Tasser and Raptor X because of length constraints of the software.
Not Available
- Million Molecules
Best 20 Hit molecules
Not Available