viHumans
Reviewed
Homo Sapiens (Human) [TaxID: 9606]
BILF1[Gene ID: 3783707 ]
G-protein coupled receptor BILF1
Epstein-Barr Virus (strain B95-8) (HHV-4) (Human Herpesvirus 4)
Viruses> DsDNA Viruses> No RNA Stage> Herpesvirales> Herpesviridae> Gammaherpesvirinae> Lymphocryptovirus> Epstein-Barr Virus (strain GD1) (HHV-4) (Human Herpesvirus 4)> Epstein-Barr Virus (strain B95-8) (HHV-4) (Human Herpesvirus 4)
Various pathway(s) in which protein is involved
Not Available
MLSTMAPGSTVGTLVANMTSVNATEDACTKSYSAFLSGMTSLLLVLLILLTLAGILFIIFVRKLVHRMDVWLIALLIELLLWVLGKMIQEFSSTGLCLLT
QNMMFLGLMCSVWTHLGMALEKTLALFSRTPKRTSHRNVCLYLMGVFCLVLLLIIILLITMGPDANLNRGPNMCREGPTKGMHTAVQGLKAGCYLLAAVL
IVLLTVIIIWKLLRTKFGRKPRLICNVTFTGLICAFSWFMLSLPLLFLGEAGSLGFDCTESLVARYYPGPAACLALLLIILYAWSFSHFMDSLKNQVTVT
ARYFRRVPSQST
312
Not Available
Not Available
21-07-1986
Evidence at protein level
Amino Acid Count % Frequency Amino Acid Count % Frequency
Alanine (A) Leucine (L)
Arginine (R) Lysine (K)
Asparagine (N) Methionine (M)
Aspartic Acid (D) Phenylalanine (F)
Cysteine (C) Proline (P)
Glutamine (Q) Serine (S)
Glutamic Acid (E) Threonine (T)
Glycine (G) Tryptophan (W)
Histidine (H) Tyrosine (Y)
Isoleucine (I) Valine (V)
% Number of Residues in Helices % Number of Residues in Strands % Number of Residues in Coils
Constitutively active G protein-coupled receptor that plays a role in the modulation of host immunity. As a consequence of its constitutive activity, mediates host CXCR4 inhibition. Enhances degradation of host major histocompatibility complex class I antigens via lysosomes. Targets also newly synthesized MHC-I/peptide complexes en route to the host cell surface. Inhibits the host EIF2AK2/PKR phosphorylation.
Not Available
GO:0016021  ;   GO:0020002  ;   GO:0039502  ;   GO:0039504  ;   GO:0039580  ;  
GO:0046776  
♦ Host cell membrane
♦ Multi-pass membrane protein .
Not Available
Not Available
Predicted/Modelled
Not Available
Not Available
Protein couldn't be modeled using I-Tasser and Raptor X because of length constraints of the software.
Not Available
Virtual screening has been performed using RASPD
  • Million Molecules

Best 20 Hit molecules

    Not Available