viHumans
Reviewed
Homo Sapiens (Human) [TaxID: 9606]
BZLF1[Gene ID: 3783744 ]
Trans-activator protein BZLF1 (EB1) (Zebra)
Epstein-Barr Virus (strain B95-8) (HHV-4) (Human Herpesvirus 4)
Viruses> DsDNA Viruses> No RNA Stage> Herpesvirales> Herpesviridae> Gammaherpesvirinae> Lymphocryptovirus> Epstein-Barr Virus (strain GD1) (HHV-4) (Human Herpesvirus 4)> Epstein-Barr Virus (strain B95-8) (HHV-4) (Human Herpesvirus 4)
Various pathway(s) in which protein is involved
Not Available
MMDPNSTSEDVKFTPDPYQVPFVQAFDQATRVYQDLGGPSQAPLPCVLWPVLPEPLPQGQLTAYHVSTAPTGSWFSAPQPAPENAYQAYAAPQLFPVSDI
TQNQQTNQAGGEAPQPGDNSTVQTAAAVVFACPGANQGQQLADIGVPQPAPVAAPARRTRKPQQPESLEECDSELEIKRYKNRVASRKCRAKFKQLLQHY
REVAAAKSSENDRLRLLLKQMCPSLDVDSIIPRTPDVLHEDLLNF
245
Not Available
Not Available
01-07-1989
Evidence at protein level
Amino Acid Count % Frequency Amino Acid Count % Frequency
Alanine (A) Leucine (L)
Arginine (R) Lysine (K)
Asparagine (N) Methionine (M)
Aspartic Acid (D) Phenylalanine (F)
Cysteine (C) Proline (P)
Glutamine (Q) Serine (S)
Glutamic Acid (E) Threonine (T)
Glycine (G) Tryptophan (W)
Histidine (H) Tyrosine (Y)
Isoleucine (I) Valine (V)
% Number of Residues in Helices % Number of Residues in Strands % Number of Residues in Coils
Plays a key role in the switch from latent infection to lytic cycle producing new virions. Acts as a transcription factor, inducing early lytic cycle genes, and as a origin binding protein for genome replication. BZLF1 activates the promoter of another EBV gene (BSLF2+BMLF1).
Not Available
GO:0003677  ;   GO:0003700  ;   GO:0006351  ;   GO:0006355  ;   GO:0019046  ;  
GO:0039557  ;   GO:0039646  ;   GO:0042025  ;   GO:0043565  ;   GO:0045893  ;  
GO:0046983  
Host nucleus .
DOMAIN 170 228 bZIP.
Not Available
X-ray crystallography (15)
1ZSD  2AK4  2AXF  2AXG  2C9L  2C9N  2NX5  3KWW  3KXF  3SPV  3VFN  3VFO  3VFP  3VFR  5SZX  
Not Available
Protein couldn't be modeled using I-Tasser and Raptor X because of length constraints of the software.
CHEMBL1293280            
Not Applicable