Reviewed
Homo Sapiens (Human) [TaxID: 9606]
Not Available
Minor capsid protein VP2 (Minor structural protein VP2)
BK Polyomavirus (BKPyV) (Human Polyomavirus 1)
Viruses> DsDNA Viruses> No RNA Stage> Polyomaviridae> Betapolyomavirus> BK Polyomavirus (BKPyV) (Human Polyomavirus 1)
Various pathway(s) in which protein is involved
Not Available
MGAALALLGDLVASVSEAAAATGFSVAEIAAGEAAAAIEVQIASLATVEGITSTSEAIAAIGLTPQTYAVIAGAPGAIAGFAALIQTVSGISSLAQVGYR
FFSDWDHKVSTVGLYQQSGMALELFNPDEYYDILFPGVNTFVNNIQYLDPRHWGPSLFATISQALWHVIRDDIPSITSQELQRRTERFFRDSLARFLEET
TWTIVNAPINFYNYIQQYYSDLSPIRPSMVRQVAEREGTRVHFGHTYSIDDADSIEEVTQRMDLRNQQSVHSGEFIEKTIAPGGANQRTAPQWMLPLLLG
LYGTVTPALEAYEDGPNQKKRRVSRGSSQKAKGTRASAKTTNKRRSRSSRS
FFSDWDHKVSTVGLYQQSGMALELFNPDEYYDILFPGVNTFVNNIQYLDPRHWGPSLFATISQALWHVIRDDIPSITSQELQRRTERFFRDSLARFLEET
TWTIVNAPINFYNYIQQYYSDLSPIRPSMVRQVAEREGTRVHFGHTYSIDDADSIEEVTQRMDLRNQQSVHSGEFIEKTIAPGGANQRTAPQWMLPLLLG
LYGTVTPALEAYEDGPNQKKRRVSRGSSQKAKGTRASAKTTNKRRSRSSRS
351
VAR_SEQ 1 228 Missing (in isoform VP4) ; VAR_SEQ 1 119 Missing (in isoform VP3)
Not Available
23-01-2007
Inferred from homology
| Amino Acid | Count | % Frequency | Amino Acid | Count | % Frequency |
|---|---|---|---|---|---|
| Alanine (A) | Leucine (L) | ||||
| Arginine (R) | Lysine (K) | ||||
| Asparagine (N) | Methionine (M) | ||||
| Aspartic Acid (D) | Phenylalanine (F) | ||||
| Cysteine (C) | Proline (P) | ||||
| Glutamine (Q) | Serine (S) | ||||
| Glutamic Acid (E) | Threonine (T) | ||||
| Glycine (G) | Tryptophan (W) | ||||
| Histidine (H) | Tyrosine (Y) | ||||
| Isoleucine (I) | Valine (V) |
| % Number of Residues in Helices | % Number of Residues in Strands | % Number of Residues in Coils |
|---|---|---|
♦Isoform VP2 is a structural protein that resides within the core of the capsid surrounded by 72 VP1 pentamers. Participates in host cell receptor binding together with VP1. Following virus endocytosis and trafficking to the endoplasmic reticulum, VP2 and VP3 form oligomers and integrate into the endoplasmic reticulum membrane. Heterooligomer VP2-VP3 may create a viroporin for transporting the viral genome across the endoplasmic reticulum membrane to the cytoplasm. Nuclear entry of the viral DNA involves the selective exposure and importin recognition of VP2 or Vp3 nuclear localization signal (shared C-terminus). Plays a role in virion assembly within the nucleus in particular through a DNA-binding domain located in the C-terminal region. A N-terminal myristoylation suggests a scaffold function for virion assembly (By similarity).
♦ Isoform VP3: structural protein that resides within the core of the capsid surrounded by 72 VP1 pentamers. Following virus endocytosis and trafficking to the endoplasmic reticulum, VP2 and VP3 form oligomers and integrate into the endoplasmic reticulum membrane. Heterooligomer VP2-VP3 may create a viroporin for transporting the viral genome across the endoplasmic reticulum membrane to the cytoplasm. Nuclear entry of the viral DNA involves the selective exposure and importin recognition of VP2 or Vp3 nuclear localization signal (shared C-terminus). Isoform VP3 plays a role in virion assembly within the nucleus. May participate in host cell lysis when associated with VP4 (By similarity).
♦ Isoform VP4 is a viroporin inducing perforation of cellular membranes to trigger virus progeny release. Forms pores of 3 nm inner diameter. VP4 is expressed about 24 hours after the late structural proteins and is not incorporated into the mature virion (By similarity).
♦ Isoform VP3: structural protein that resides within the core of the capsid surrounded by 72 VP1 pentamers. Following virus endocytosis and trafficking to the endoplasmic reticulum, VP2 and VP3 form oligomers and integrate into the endoplasmic reticulum membrane. Heterooligomer VP2-VP3 may create a viroporin for transporting the viral genome across the endoplasmic reticulum membrane to the cytoplasm. Nuclear entry of the viral DNA involves the selective exposure and importin recognition of VP2 or Vp3 nuclear localization signal (shared C-terminus). Isoform VP3 plays a role in virion assembly within the nucleus. May participate in host cell lysis when associated with VP4 (By similarity).
♦ Isoform VP4 is a viroporin inducing perforation of cellular membranes to trigger virus progeny release. Forms pores of 3 nm inner diameter. VP4 is expressed about 24 hours after the late structural proteins and is not incorporated into the mature virion (By similarity).
Not Available
GO:0003677 ; GO:0005198 ; GO:0005216 ; GO:0016021 ; GO:0019028 ;
GO:0019062 ; GO:0039665 ; GO:0039707 ; GO:0042025 ; GO:0044167 ;
GO:0044385 ; GO:0051259 ; GO:0075732 ; GO:0099008
GO:0019062 ; GO:0039665 ; GO:0039707 ; GO:0042025 ; GO:0044167 ;
GO:0044385 ; GO:0051259 ; GO:0075732 ; GO:0099008
♦ Isoform VP2: Virion. Host nucleus. Host endoplasmic reticulum. Host endoplasmic reticulum membrane .
♦ Isoform VP3: Virion. Host nucleus. Host endoplasmic reticulum. Host endoplasmic reticulum membrane .
♦ Isoform VP4: Host nucleus .
♦ Isoform VP3: Virion. Host nucleus. Host endoplasmic reticulum. Host endoplasmic reticulum membrane .
♦ Isoform VP4: Host nucleus .
Not Available
MOTIF 315 323 Nuclear localization signal.
Predicted/Modelled
Not Available
Not Available
Protein couldn't be modeled using I-Tasser and Raptor X because of length constraints of the software.
Not Available
- Million Molecules
Best 20 Hit molecules
Not Available