Results | viHumans

UniProt ID

P03089

Status

Reviewed

Host

Homo Sapiens (Human) [TaxID: 9606]

Gene Name

Not Available

Protein Name

Major capsid protein VP1 (Major structural protein VP1)

Organism Name

JC Polyomavirus (JCPyV) (JCV)

Taxonomic Lineage

Viruses> DsDNA Viruses> No RNA Stage> Polyomaviridae> Betapolyomavirus> Human Polyomavirus 2> JC Polyomavirus (JCPyV) (JCV)

RefSeq

Not Available

PubMed ID

6086957 ; 8389465 ; 7915447 ; 7823412 ; 9573227 ; 10666259 ; 15069063 ; 15550673 ; 19157477 ;
15331723 ; 19157478 ; 20951965

Pathways Involved

Various pathway(s) in which protein is involved

KEGG

vg:1489518

Reactome

Not Available

Sequence

							MAPTKRKGERKDPVQVPKLLIRGGVEVLEVKTGVDSITEVECFLTPEMGDPDEHLRGFSKSISISDTFESDSPNRDMLPCYSVARIPLPNLNEDLTCGNI
LMWEAVTLKTEVIGVTSLMNVHSNGQATHDNGAGKPVQGTSFHFFSVGGEALELQGVLFNYRTKYPDGTIFPKNATVQSQVMNTEHKAYLDKNKAYPVEC
WVPDPTRNENTRYFGTLTGGENVPPVLHITNTATTVLLDEFGVGPLCKGDNLYLSAVDVCGMFTNRSGSQQWRGLSRYFKVQLRKRRVKNPYPISFLLTD
LINRRTPRVDGQPMYGMDAQVEEVRVFEGTEELPGDPDMMRYVDKYGQLQTKML
						

Length

354

Alternate Sequence

Not Available

Non-standard residue

Not Available

Date of last Sequence modification

21-07-1986

Protein Existence

Evidence at protein level

Amino Acid composition

Amino Acid	Count	% Frequency	Amino Acid	Count	% Frequency
Alanine (A)			Leucine (L)
Arginine (R)			Lysine (K)
Asparagine (N)			Methionine (M)
Aspartic Acid (D)			Phenylalanine (F)
Cysteine (C)			Proline (P)
Glutamine (Q)			Serine (S)
Glutamic Acid (E)			Threonine (T)
Glycine (G)			Tryptophan (W)
Histidine (H)			Tyrosine (Y)
Isoleucine (I)			Valine (V)

Sum of Absolute Deviation from Amino Acid Occurrence Frequencies

Aliphatic Index

Instability Index

Secondary Structure features

% Number of Residues in Helices	% Number of Residues in Strands	% Number of Residues in Coils

Structural Difficulty(SD) index

Role(s)

Forms an icosahedral capsid with a T=7 symmetry and a 40 nm diameter. The capsid is composed of 72 pentamers linked to each other by disulfide bonds and associated with VP2 or VP3 proteins. Interacts with a N-linked glycoprotein containing terminal alpha(2-6)-linked sialic acids on the cell surface to provide virion attachment to target cell. The serotonergic receptor 5HT2AR also acts as a cellular receptor for JCV on human glial cells. Once attached, the virions enter predominantly by a ligand-inducible clathrin-dependent pathway and traffic to the ER. Inside the endoplasmic reticulum, the protein folding machinery isomerizes VP1 interpentamer disulfide bonds, thereby triggering initial uncoating. Next, the virion uses the endoplasmic reticulum-associated degradation machinery to probably translocate in the cytosol before reaching the nucleus. Nuclear entry of the viral DNA involves the selective exposure and importin recognition of VP2/Vp3 nuclear localization signal. In late phase of infection, neo-synthesized VP1 encapsulates replicated genomic DNA at nuclear domains called promyelocytic leukemia (PML) bodies, and participates in rearranging nucleosomes around the viral DNA.

EC

Not Available

Experimentally known GO terms

GO:0005198 ; GO:0019062 ; GO:0039620 ; GO:0042025 ; GO:0075512

Subcellular Location

Virion. Host nucleus . Note=Virions are efficiently assembled at nuclear domain 10 (ND10), which is also known as promyelocytic leukemia (PML) nuclear bodies. .

Domain(s)

Not Available

Motif(s)

Not Available

Methods of 3D structure generation

X-ray crystallography (12)

Experimetally known structure

3NXD 3NXG 4JCD 4JCE 4JCF 4WDY 4WDZ 4WE0 4X14 4X15 4X16 4X17

Active Site(s)

Not Available

Predicted 3D Structures

Protein couldn't be modeled using I-Tasser and Raptor X because of length constraints of the software.

Experimentally known Ligand(s)

Not Available

Virtually Screened Ligands

Virtual screening has been performed using RASPD

						Million Molecules

					
Best 20 Hit molecules 
Not Available