Reviewed
Homo Sapiens (Human) [TaxID: 9606]
Not Available
Agnoprotein (Agno)
BK Polyomavirus (BKPyV) (Human Polyomavirus 1)
Viruses> DsDNA Viruses> No RNA Stage> Polyomaviridae> Betapolyomavirus> BK Polyomavirus (BKPyV) (Human Polyomavirus 1)
Various pathway(s) in which protein is involved
Not Available
MVLRQLSRQASVKVGKTWTGTKKRAQRIFIFILELLLEFCRGEDSVDGKNKSTTALPAVKDSVKDS
66
Not Available
Not Available
21-07-1986
Inferred from homology
Amino Acid | Count | % Frequency | Amino Acid | Count | % Frequency |
---|---|---|---|---|---|
Alanine (A) | Leucine (L) | ||||
Arginine (R) | Lysine (K) | ||||
Asparagine (N) | Methionine (M) | ||||
Aspartic Acid (D) | Phenylalanine (F) | ||||
Cysteine (C) | Proline (P) | ||||
Glutamine (Q) | Serine (S) | ||||
Glutamic Acid (E) | Threonine (T) | ||||
Glycine (G) | Tryptophan (W) | ||||
Histidine (H) | Tyrosine (Y) | ||||
Isoleucine (I) | Valine (V) |
% Number of Residues in Helices | % Number of Residues in Strands | % Number of Residues in Coils |
---|---|---|
Alters the structure of the nuclear envelope by interacting with host CBX5 and disrupting CBX5 association with LBR. Involved in the perinuclear-nuclear localization of the capsid protein VP1 during virion assembly and maturation. Plays an important role in the release of progeny virions from infected cells and in viral propagation, probably by acting as a viral ionic channel in the host plasma membrane. Allows influx of extracellular calcium ions in the host cell. May contribute to viral genome transcription and translation of viral late proteins (By similarity).
Not Available
GO:0003677 ; GO:0005216 ; GO:0016021 ; GO:0020002 ; GO:0039707 ;
GO:0044169 ; GO:0044200 ; GO:0044385 ; GO:0051259
GO:0044169 ; GO:0044200 ; GO:0044385 ; GO:0051259
♦ Host cytoplasm . Host nucleus membrane
♦ Single-pass type II membrane protein . Host rough endoplasmic reticulum membrane
♦ Single-pass type II membrane protein . Host cell membrane
♦ Single-pass type II membrane protein . Note=Mostly perinuclear. .
♦ Single-pass type II membrane protein . Host rough endoplasmic reticulum membrane
♦ Single-pass type II membrane protein . Host cell membrane
♦ Single-pass type II membrane protein . Note=Mostly perinuclear. .
Not Available
Not Available
Predicted/Modelled
Not Available
Not Available
Protein couldn't be modeled using I-Tasser and Raptor X because of length constraints of the software.
Not Available
- Million Molecules
Best 20 Hit molecules
Not Available