viHumans
Reviewed
Homo Sapiens (Human) [TaxID: 9606]
Not Available
Small t antigen (ST) (ST-AG)
BK Polyomavirus (BKPyV) (Human Polyomavirus 1)
Viruses> DsDNA Viruses> No RNA Stage> Polyomaviridae> Betapolyomavirus> BK Polyomavirus (BKPyV) (Human Polyomavirus 1)
Various pathway(s) in which protein is involved
Not Available
MDKVLNREESMELMDLLGLERAAWGNLPLMRKAYLRKCKEFHPDKGGDEDKMKRMNTLYKKMEQDVKVAHQPDFGTWSSSEVCADFPLCPDTLYCKEWPI
CSKKPSVHCPCMLCQLRLRHLNRKFLRKEPLVWIDCYCIDCFTQWFGLDLTEETLQWWVQIIGETPFRDLKL
172
Not Available
Not Available
21-07-1986
Inferred from homology
Amino Acid Count % Frequency Amino Acid Count % Frequency
Alanine (A) Leucine (L)
Arginine (R) Lysine (K)
Asparagine (N) Methionine (M)
Aspartic Acid (D) Phenylalanine (F)
Cysteine (C) Proline (P)
Glutamine (Q) Serine (S)
Glutamic Acid (E) Threonine (T)
Glycine (G) Tryptophan (W)
Histidine (H) Tyrosine (Y)
Isoleucine (I) Valine (V)
% Number of Residues in Helices % Number of Residues in Strands % Number of Residues in Coils
Promotes efficient viral genome replication by accelerating both G1 and S phase progression of the cell cycle. Inhibits host PP2A by binding to the A subunit, thereby displacing lower affinity regulatory B subunit. Inactivation of PP2A in turn results in the transactivation of cyclin A and cyclin D1 promoters. Late during the infection cycle, ST may induce dephosphorylation of host MTOR, leading to the inhibition of cap-dependent translation. May establish and maintain high levels of viral genomes during persistent infection in cell culture.
Not Available
GO:0006351  ;   GO:0006355  ;   GO:0016032  ;   GO:0030430  ;   GO:0042025  ;  
GO:0046872  
Host cytoplasm. Host nucleus .
DOMAIN 12 75 J.
Not Available
Predicted/Modelled
Not Available
Not Available
Protein couldn't be modeled using I-Tasser and Raptor X because of length constraints of the software.
Not Available
Virtual screening has been performed using RASPD
  • Million Molecules

Best 20 Hit molecules

    Not Available