Reviewed
Homo Sapiens (Human) [TaxID: 9606]
Vif
♦Virion infectivity factor (Vif) (SOR protein) [Cleaved into: p17
♦ p7]
♦ p7]
Human Immunodeficiency Virus Type 1 Group M Subtype G (isolate SE6165) (HIV-1)
Viruses> Retro-transcribing Viruses> Retroviridae> Orthoretrovirinae> Lentivirus> Primate Lentivirus Group> Human Immunodeficiency Virus 1> HIV-1 Group M> HIV-1 M:G> Human Immunodeficiency Virus Type 1 Group M Subtype G (isolate SE6165) (HIV-1)
Various pathway(s) in which protein is involved
Not Available
Not Available
MENRWQVMIVWQVDRMRIRTWHSLVKHHMYVSKKARGWFYRPHYASRHPRVSSEVHIPLGDATLVVTTYWGLHTGEKDWQLGHGVSIEWRQRRYRTQVEP
DLADHLIHLHYFDCFSDSAIRKAILGQIVSPRCEYQAGHNQVGSLQYLALKVLVTSKRSRPPLPSVTELAEDRWNKPQKTRGHRENPTMNGH
DLADHLIHLHYFDCFSDSAIRKAILGQIVSPRCEYQAGHNQVGSLQYLALKVLVTSKRSRPPLPSVTELAEDRWNKPQKTRGHRENPTMNGH
192
Not Available
Not Available
01-11-1998
Inferred from homology
Amino Acid | Count | % Frequency | Amino Acid | Count | % Frequency |
---|---|---|---|---|---|
Alanine (A) | Leucine (L) | ||||
Arginine (R) | Lysine (K) | ||||
Asparagine (N) | Methionine (M) | ||||
Aspartic Acid (D) | Phenylalanine (F) | ||||
Cysteine (C) | Proline (P) | ||||
Glutamine (Q) | Serine (S) | ||||
Glutamic Acid (E) | Threonine (T) | ||||
Glycine (G) | Tryptophan (W) | ||||
Histidine (H) | Tyrosine (Y) | ||||
Isoleucine (I) | Valine (V) |
% Number of Residues in Helices | % Number of Residues in Strands | % Number of Residues in Coils |
---|---|---|
Counteracts the innate antiviral activity of host APOBEC3F and APOBEC3G. Forms a complex with host APOBEC3F and APOBEC3G thus preventing the entry of these lethally hypermutating enzymes into progeny virions. Recruits an active E3 ubiquitin ligase complex composed of elongin BC, CUL5, and RBX2 to induce polyubiquitination of APOBEC3G and APOBEC3F. In turn, they are directed to the 26S proteasome for degradation. Vif interaction with APOBEC3G also blocks its cytidine deaminase activity in a proteasome-independent manner, suggesting a dual inhibitory mechanism. May interact directly with APOBEC3G mRNA in order to inhibit its translation. Seems to play a role in viral morphology by affecting the stability of the viral nucleoprotein core. Finally, Vif also contributes to the G2 cell cycle arrest observed in HIV infected cells.
Not Available
♦ Host cytoplasm . Host cell membrane
♦ Peripheral membrane protein
♦ Cytoplasmic side . Virion . Note=In the cytoplasm, seems to colocalize with intermediate filament vimentin. A fraction is associated with the cytoplasmic side of cellular membranes, presumably via the interaction with Pr55Gag precursor. Incorporated in virions at a ratio of approximately 7 to 20 molecules per virion. .
♦ Peripheral membrane protein
♦ Cytoplasmic side . Virion . Note=In the cytoplasm, seems to colocalize with intermediate filament vimentin. A fraction is associated with the cytoplasmic side of cellular membranes, presumably via the interaction with Pr55Gag precursor. Incorporated in virions at a ratio of approximately 7 to 20 molecules per virion. .
Not Available
MOTIF 108 139 HCCH motif. ; MOTIF 144 153 BC-box-like motif.
Predicted/Modelled
Not Available
Not Available
Protein couldn't be modeled using I-Tasser and Raptor X because of length constraints of the software.
Not Available
- Million Molecules
Best 20 Hit molecules
Not Available