Reviewed
Homo Sapiens (Human) [TaxID: 9606]
VPK1 MVA167R ACAM3000_MVA_167 B1R
B1 kinase (Serine/threonine-protein kinase 1) (EC 2.7.11.1)
Vaccinia Virus (strain Ankara) (VACV)
Viruses> DsDNA Viruses> No RNA Stage> Poxviridae> Chordopoxvirinae> Orthopoxvirus> Vaccinia Virus> Vaccinia Virus (strain Ankara) (VACV)
9601507 ;
Various pathway(s) in which protein is involved
Not Available
Not Available
MNFQGLVLTDNCKNQWVVGPLIGKGGFGSIYTTNDNNYVVKIEPKANGSLFTEQAFYTRVLKPSVIEEWKKSHNIKHVGLITCKAFGLYKSINVEYRFLV
INRLGADLDAVIRANNNRLPKRSVMLIGIEILNTIQFMHEQGYSHGDIKASNIVLDQIDKNKLYLVDYGLVSKFMSNGEHVPFIRNPNKMDNGTLEFTPI
DSHKGYVVSRRGDLETLGYCMIRWLGGILPWTKISETKNCALVSATKQKYVNNTATLLMTSLQYAPRELLQYITMVNSLTYFEEPNYDKFRHILMQGVYY
INRLGADLDAVIRANNNRLPKRSVMLIGIEILNTIQFMHEQGYSHGDIKASNIVLDQIDKNKLYLVDYGLVSKFMSNGEHVPFIRNPNKMDNGTLEFTPI
DSHKGYVVSRRGDLETLGYCMIRWLGGILPWTKISETKNCALVSATKQKYVNNTATLLMTSLQYAPRELLQYITMVNSLTYFEEPNYDKFRHILMQGVYY
300
Not Available
Not Available
01-06-1998
Inferred from homology
| Amino Acid | Count | % Frequency | Amino Acid | Count | % Frequency |
|---|---|---|---|---|---|
| Alanine (A) | Leucine (L) | ||||
| Arginine (R) | Lysine (K) | ||||
| Asparagine (N) | Methionine (M) | ||||
| Aspartic Acid (D) | Phenylalanine (F) | ||||
| Cysteine (C) | Proline (P) | ||||
| Glutamine (Q) | Serine (S) | ||||
| Glutamic Acid (E) | Threonine (T) | ||||
| Glycine (G) | Tryptophan (W) | ||||
| Histidine (H) | Tyrosine (Y) | ||||
| Isoleucine (I) | Valine (V) |
| % Number of Residues in Helices | % Number of Residues in Strands | % Number of Residues in Coils |
|---|---|---|
♦Essential serine/threonine-protein kinase that plays different role in the viral life cycle. Phosphorylates the host small ribosomal protein RACK1 thereby customizing the ribosomes to a state optimal for viral mRNAs (which contain poly-A leaders) but not for host mRNAs. Facilitates viral DNA replication by inhibiting host BANF1, a cellular host defense responsive to foreign DNA. Phosphorylates host BANF1 on serine and threonine residues
♦ this leads to BANF1 relocalization to the cytoplasm, loss of dimerization and impaired DNA binding activity. Indeed, BANF1 activity depends on its DNA-binding property which is blocked by VPK1-mediated phosphorylation. Required for viral intermediate genes expression, probably by inhibiting host BANF1. Modulates cellular responses via host JUN by two different mechanisms, either by direct phosphorylation or by modulation of upstream JIP1-MAPK complexes. Seems to participates in the accumulation/processing of late proteins and thus in virion maturation.
♦ this leads to BANF1 relocalization to the cytoplasm, loss of dimerization and impaired DNA binding activity. Indeed, BANF1 activity depends on its DNA-binding property which is blocked by VPK1-mediated phosphorylation. Required for viral intermediate genes expression, probably by inhibiting host BANF1. Modulates cellular responses via host JUN by two different mechanisms, either by direct phosphorylation or by modulation of upstream JIP1-MAPK complexes. Seems to participates in the accumulation/processing of late proteins and thus in virion maturation.
2.7.11.1
Virion . Host cytoplasm . Note=Localizes in cytoplasmic viral factories and is a minor component of the virion. .
DOMAIN 16 282 Protein kinase.
Not Available
Predicted/Modelled
Not Available
ACT_SITE 147 147 Proton acceptor.
Protein couldn't be modeled using I-Tasser and Raptor X because of length constraints of the software.
Not Available
- Million Molecules
Best 20 Hit molecules
Not Available