Reviewed
Homo Sapiens (Human) [TaxID: 9606]
MVA123L ACAM3000_MVA_123 A12L
25 kDa core protein A12L [Cleaved into: 17 kDa core protein A12L (17K)]
Vaccinia Virus (strain Ankara) (VACV)
Viruses> DsDNA Viruses> No RNA Stage> Poxviridae> Chordopoxvirinae> Orthopoxvirus> Vaccinia Virus> Vaccinia Virus (strain Ankara) (VACV)
9601507 ;
Various pathway(s) in which protein is involved
Not Available
Not Available
MADKKNLAVRSSYDDYIETVNKITPQLKNLLAQIGGDAAVKGGNNNLNSQTDVTAGACDTKCITCKPKSKSSSSSTSTSKGSKNTSGAPRRRTTVTTTSY
NAMDGQIVQAVTNAGKIVYGTVRDGQLEVRGMVGEINHDLLGIDSVNAGKKKPSKKMPTNKKINMSSGMRRQEQINPDDCCLDMGMY
NAMDGQIVQAVTNAGKIVYGTVRDGQLEVRGMVGEINHDLLGIDSVNAGKKKPSKKMPTNKKINMSSGMRRQEQINPDDCCLDMGMY
187
Not Available
Not Available
01-06-1998
Evidence at transcript level
| Amino Acid | Count | % Frequency | Amino Acid | Count | % Frequency |
|---|---|---|---|---|---|
| Alanine (A) | Leucine (L) | ||||
| Arginine (R) | Lysine (K) | ||||
| Asparagine (N) | Methionine (M) | ||||
| Aspartic Acid (D) | Phenylalanine (F) | ||||
| Cysteine (C) | Proline (P) | ||||
| Glutamine (Q) | Serine (S) | ||||
| Glutamic Acid (E) | Threonine (T) | ||||
| Glycine (G) | Tryptophan (W) | ||||
| Histidine (H) | Tyrosine (Y) | ||||
| Isoleucine (I) | Valine (V) |
| % Number of Residues in Helices | % Number of Residues in Strands | % Number of Residues in Coils |
|---|---|---|
Component of the virion core that undergoes proteolytic processing during the immature virion (IV) to mature virion (MV) transition. Essential for the formation of a structurally normal core (By similarity).
Not Available
♦ 25 kDa core protein A12L: Virion . Note=Localizes to the virion core. .
♦ 17 kDa core protein A12L: Virion . Note=Localizes to the virion core. .
♦ 17 kDa core protein A12L: Virion . Note=Localizes to the virion core. .
Not Available
Not Available
Predicted/Modelled
Not Available
Not Available
Protein couldn't be modeled using I-Tasser and Raptor X because of length constraints of the software.
Not Available
- Million Molecules
Best 20 Hit molecules
Not Available