Reviewed
Homo Sapiens (Human) [TaxID: 9606]
MVA120L ACAM3000_MVA_120 A9L
Virion membrane protein A9
Vaccinia Virus (strain Ankara) (VACV)
Viruses> DsDNA Viruses> No RNA Stage> Poxviridae> Chordopoxvirinae> Orthopoxvirus> Vaccinia Virus> Vaccinia Virus (strain Ankara) (VACV)
9601507 ;
Various pathway(s) in which protein is involved
Not Available
Not Available
MSCYTAILKSVGGLALFQVANGAIDLCRHFFMYFCEQKLRPNSFWFVVVRAIASMIMYLVLGIALLYISEQDNKKNTNNDKRNESSINSNSSPK
94
Not Available
Not Available
01-06-1998
Evidence at transcript level
| Amino Acid | Count | % Frequency | Amino Acid | Count | % Frequency |
|---|---|---|---|---|---|
| Alanine (A) | Leucine (L) | ||||
| Arginine (R) | Lysine (K) | ||||
| Asparagine (N) | Methionine (M) | ||||
| Aspartic Acid (D) | Phenylalanine (F) | ||||
| Cysteine (C) | Proline (P) | ||||
| Glutamine (Q) | Serine (S) | ||||
| Glutamic Acid (E) | Threonine (T) | ||||
| Glycine (G) | Tryptophan (W) | ||||
| Histidine (H) | Tyrosine (Y) | ||||
| Isoleucine (I) | Valine (V) |
| % Number of Residues in Helices | % Number of Residues in Strands | % Number of Residues in Coils |
|---|---|---|
Envelope protein. Required for an early step in virion morphogenesis (By similarity).
Not Available
♦ Virion membrane
♦ Single-pass membrane protein . Host cytoplasm . Note=Component of the mature virion (MV) membrane. The mature virion is located in the cytoplasm of infected cells and is probably released by cell lysis. Also found in cytoplasmic virus factories (By similarity). .
♦ Single-pass membrane protein . Host cytoplasm . Note=Component of the mature virion (MV) membrane. The mature virion is located in the cytoplasm of infected cells and is probably released by cell lysis. Also found in cytoplasmic virus factories (By similarity). .
Not Available
Not Available
Predicted/Modelled
Not Available
Not Available
Protein couldn't be modeled using I-Tasser and Raptor X because of length constraints of the software.
Not Available
- Million Molecules
Best 20 Hit molecules
Not Available