viHumans
Reviewed
Homo Sapiens (Human) [TaxID: 9606]
MVA073L ACAM3000_MVA_073
Glutaredoxin-2
Vaccinia Virus (strain Ankara) (VACV)
Viruses> DsDNA Viruses> No RNA Stage> Poxviridae> Chordopoxvirinae> Orthopoxvirus> Vaccinia Virus> Vaccinia Virus (strain Ankara) (VACV)
Various pathway(s) in which protein is involved
Not Available
Not Available
MKNVLIIFGKPYCSICENVSDAVEELKSEYDILHVDILSFFLKDGDSSMLGDVKRGTLIGNFAAHLSNYIVSIFKYNPQTKQMAFVDINKSLDFTKTDKS
LVNLEILKSEIEKANYGVWPPVTE
124
Not Available
Not Available
01-06-1998
Inferred from homology
Amino Acid Count % Frequency Amino Acid Count % Frequency
Alanine (A) Leucine (L)
Arginine (R) Lysine (K)
Asparagine (N) Methionine (M)
Aspartic Acid (D) Phenylalanine (F)
Cysteine (C) Proline (P)
Glutamine (Q) Serine (S)
Glutamic Acid (E) Threonine (T)
Glycine (G) Tryptophan (W)
Histidine (H) Tyrosine (Y)
Isoleucine (I) Valine (V)
% Number of Residues in Helices % Number of Residues in Strands % Number of Residues in Coils
Glutaredoxin necessary for virion morphogenesis and virus replication. Redox shuttle between membrane-associated E10R and L1R or F9L. Exhibit thioltransferase and dehydroascorbate reductase activities in vitro (By similarity).
Not Available
Host cytoplasm .
Not Available
Not Available
Predicted/Modelled
Not Available
Not Available
Protein couldn't be modeled using I-Tasser and Raptor X because of length constraints of the software.
Not Available
Virtual screening has been performed using RASPD
  • Million Molecules

Best 20 Hit molecules

    Not Available