Reviewed
Homo Sapiens (Human) [TaxID: 9606]; Mammalia [TaxID: 40674]
P
Phosphoprotein (Protein P) (Protein M1)
Lagos Bat Virus (LBV)
Viruses> SsRNA Viruses> SsRNA Negative-strand Viruses> Mononegavirales> Rhabdoviridae> Lyssavirus> Lagos Bat Virus (LBV)
Various pathway(s) in which protein is involved
Not Available
Not Available
MSKGLIHPSAIRSGLVDLEMAEETVDLVHKNLADSQAHLQGEPLNVDSLPEDMRKMRLTNAPSEREIIEEDEEEYSSEDEYYLSQGQDPMVPFQNFLDEL
GTQIVRRMKSGDGFFKIWSAASEDIKGYVLSTFMKPETQATVSKPTQTDSLSVPRPSQGYTSVPRDKPSNSESQGGGVKPKKVQKSEWTRDTDEISDIEG
EVAHQVAESFSKKYKFPSRSSGIFLWNFEQLKMNLDDIVKTSMNVPGVDKIAEKGGKLPLRCILGFVSLDSSKRFRLLADTDKVARLMQDDIHNYMTRIE
EIDHN
GTQIVRRMKSGDGFFKIWSAASEDIKGYVLSTFMKPETQATVSKPTQTDSLSVPRPSQGYTSVPRDKPSNSESQGGGVKPKKVQKSEWTRDTDEISDIEG
EVAHQVAESFSKKYKFPSRSSGIFLWNFEQLKMNLDDIVKTSMNVPGVDKIAEKGGKLPLRCILGFVSLDSSKRFRLLADTDKVARLMQDDIHNYMTRIE
EIDHN
305
VAR_SEQ 1 52 Missing (in isoform P3) ; VAR_SEQ 1 19 Missing (in isoform P2)
Not Available
01-06-1998
Evidence at transcript level
| Amino Acid | Count | % Frequency | Amino Acid | Count | % Frequency |
|---|---|---|---|---|---|
| Alanine (A) | Leucine (L) | ||||
| Arginine (R) | Lysine (K) | ||||
| Asparagine (N) | Methionine (M) | ||||
| Aspartic Acid (D) | Phenylalanine (F) | ||||
| Cysteine (C) | Proline (P) | ||||
| Glutamine (Q) | Serine (S) | ||||
| Glutamic Acid (E) | Threonine (T) | ||||
| Glycine (G) | Tryptophan (W) | ||||
| Histidine (H) | Tyrosine (Y) | ||||
| Isoleucine (I) | Valine (V) |
| % Number of Residues in Helices | % Number of Residues in Strands | % Number of Residues in Coils |
|---|---|---|
Non catalytic polymerase cofactor and regulatory protein that plays a role in viral transcription and replication. Stabilizes the RNA polymerase L to the N-RNA template and binds the soluble protein N, preventing it from encapsidating non-genomic RNA. Also inhibits host IFN-alpha and IFN-beta signaling by binding and retaining phosphorylated STAT1 in the cytoplasm or by inhibiting the DNA binding of STAT1 in the nucleus (By similarity).
Not Available
GO:0003968 ; GO:0019012 ; GO:0019083 ; GO:0030430 ; GO:0039502 ;
GO:0039563 ; GO:0039564 ; GO:0042025
GO:0039563 ; GO:0039564 ; GO:0042025
♦ Phosphoprotein: Virion. Host cytoplasm .
♦ Isoform P2: Host cytoplasm .
♦ Isoform P3: Host nucleus .
♦ Isoform P2: Host cytoplasm .
♦ Isoform P3: Host nucleus .
Not Available
MOTIF 49 58 Nuclear export signal. ; MOTIF 212 215 Nuclear localization signal.
Predicted/Modelled
Not Available
Not Available
Protein couldn't be modeled using I-Tasser and Raptor X because of length constraints of the software.
Not Available
- Million Molecules
Best 20 Hit molecules
Not Available