viHumans
Reviewed
Equus Caballus (Horse) [TaxID: 9796]; Homo Sapiens (Human) [TaxID: 9606]; Pteropus Alecto (Black Flying Fox) [TaxID: 9402]; Pteropus Poliocephalus (Grey-headed Flying Fox) [TaxID: 9403]; Pteropus Scapulatus (Little Red Flying Fox) [TaxID: 94117]
P/V/C[Gene ID: 1446469 ]
Protein C
Hendra Virus (isolate Horse/Autralia/Hendra/1994)
Viruses> SsRNA Viruses> SsRNA Negative-strand Viruses> Mononegavirales> Paramyxoviridae> Henipavirus> Hendra Henipavirus> Hendra Virus (isolate Horse/Autralia/Hendra/1994)
Various pathway(s) in which protein is involved
Not Available
Not Available
MMASILLTLFRRTKKKYKRHTDDQASNNQVPKTGQEHGRTSCRAPVENMNRLRGECLRMMEVLKEEMWRIYPVLLPQMELLDKECQTPELGQKTQMTYNW
TQWLQTLYTMIMEENVPDMDLLQALREGGVITCQEHTMGMYVLYLIQRCCPMLPKLQFLKKLGKLI
166
Not Available
Not Available
01-06-1998
Evidence at transcript level
Amino Acid Count % Frequency Amino Acid Count % Frequency
Alanine (A) Leucine (L)
Arginine (R) Lysine (K)
Asparagine (N) Methionine (M)
Aspartic Acid (D) Phenylalanine (F)
Cysteine (C) Proline (P)
Glutamine (Q) Serine (S)
Glutamic Acid (E) Threonine (T)
Glycine (G) Tryptophan (W)
Histidine (H) Tyrosine (Y)
Isoleucine (I) Valine (V)
% Number of Residues in Helices % Number of Residues in Strands % Number of Residues in Coils
May counteract the cellular interferon antiviral system.
Not Available
Not Available
Not Available
Not Available
Predicted/Modelled
Not Available
Not Available
Protein couldn't be modeled using I-Tasser and Raptor X because of length constraints of the software.
Not Available
Virtual screening has been performed using RASPD
  • Million Molecules

Best 20 Hit molecules

    Not Available