viHumans
Reviewed
Homo Sapiens (Human) [TaxID: 9606]
SH 1A[Gene ID: 1489823 ]
Small hydrophobic protein (Small protein 1A)
Human Respiratory Syncytial Virus B (strain B1)
Viruses> SsRNA Viruses> SsRNA Negative-strand Viruses> Mononegavirales> Pneumoviridae> Orthopneumovirus> Human Respiratory Syncytial Virus> Human Respiratory Syncytial Virus B> Human Respiratory Syncytial Virus B (strain B1)
Not Available
Various pathway(s) in which protein is involved
Not Available
MGNTSITIEFTSKFWPYFTLIHMILTLISLLIIITIMIAILNKLSEHKTFCNNTLELGQMHQINT
65
Not Available
Not Available
01-01-1998
Inferred from homology
Amino Acid Count % Frequency Amino Acid Count % Frequency
Alanine (A) Leucine (L)
Arginine (R) Lysine (K)
Asparagine (N) Methionine (M)
Aspartic Acid (D) Phenylalanine (F)
Cysteine (C) Proline (P)
Glutamine (Q) Serine (S)
Glutamic Acid (E) Threonine (T)
Glycine (G) Tryptophan (W)
Histidine (H) Tyrosine (Y)
Isoleucine (I) Valine (V)
% Number of Residues in Helices % Number of Residues in Strands % Number of Residues in Coils
May form a proton-selective ion channel, playing a role in budding and /or during virus entry. May also play a role in counteracting host innate immunity (By similarity).
Not Available
GO:0006811  ;   GO:0016021  ;   GO:0020002  ;   GO:0055036  
♦ Virion membrane
♦ Single-pass type II membrane protein . Host cell membrane
♦ Single-pass type II membrane protein .
Not Available
Not Available
Predicted/Modelled
Not Available
Not Available
Protein couldn't be modeled using I-Tasser and Raptor X because of length constraints of the software.
Not Available
Virtual screening has been performed using RASPD
  • Million Molecules

Best 20 Hit molecules

    Not Available