viHumans
O09800
Reviewed
Homo Sapiens (Human) [TaxID: 9606]
GN UL49.5 UL49A[Gene ID: 2703419 ]
Envelope glycoprotein N
Human Herpesvirus 1 (strain 17) (HHV-1) (Human Herpes Simplex Virus 1)
Viruses> DsDNA Viruses> No RNA Stage> Herpesvirales> Herpesviridae> Alphaherpesvirinae> Simplexvirus> Human Herpesvirus 1 (HHV-1) (Human Herpes Simplex Virus 1)> Human Herpesvirus 1 (strain 17) (HHV-1) (Human Herpes Simplex Virus 1)
Not Available
2839594 ;  17229708 ;  18596102 ;  25505065 ;  26999189 
Various pathway(s) in which protein is involved
vg:2703419
Not Available
MGPPRRVCRAGLLFVLLVALAAGDAGPRGEPPGEEGGRDGIGGARCETQNTGQMSAPGALVPFYVGMASMGVCIIAHVCQICQRLLAAGHA
91
Not Available
Not Available
01-07-1997
Evidence at protein level
Amino Acid Count % Frequency Amino Acid Count % Frequency
Alanine (A) Leucine (L)
Arginine (R) Lysine (K)
Asparagine (N) Methionine (M)
Aspartic Acid (D) Phenylalanine (F)
Cysteine (C) Proline (P)
Glutamine (Q) Serine (S)
Glutamic Acid (E) Threonine (T)
Glycine (G) Tryptophan (W)
Histidine (H) Tyrosine (Y)
Isoleucine (I) Valine (V)
% Number of Residues in Helices % Number of Residues in Strands % Number of Residues in Coils
Envelope glycoprotein necessary for proper maturation of gM and modulation of its membrane fusion activity. Plays also a critical role in virion morphogenesis.
Not Available
GO:0016021  ;   GO:0019031  ;   GO:0033644  ;   GO:0044177  ;   GO:0055036  
♦ Virion membrane ,
♦ Single-pass type I membrane protein . Host membrane
♦ Single-pass type I membrane protein . Host Golgi apparatus, host trans-Golgi network , , . Note=When coexpressed with gM, localizes in the host trans-Golgi network. , .
Not Available
Not Available
Predicted/Modelled
Not Available
Not Available
Protein couldn't be modeled using I-Tasser and Raptor X because of length constraints of the software.
CHEMBL2364696            
Not Applicable