viHumans
Reviewed
Homo Sapiens (Human) [TaxID: 9606]
TRM3 ORF29[Gene ID: 4961443 ]
Tripartite terminase subunit 3 (EC 3.1.-.-) (Terminase large subunit)
Human Herpesvirus 8 Type P (isolate GK18) (HHV-8) (Kaposi's Sarcoma-associated Herpesvirus)
Viruses> DsDNA Viruses> No RNA Stage> Herpesvirales> Herpesviridae> Gammaherpesvirinae> Rhadinovirus> Human Herpesvirus 8 (HHV-8) (Kaposi's Sarcoma-associated Herpesvirus)> Human Herpesvirus 8 Type P (isolate GK18) (HHV-8) (Kaposi's Sarcoma-associated Herpesvirus)
Various pathway(s) in which protein is involved
Not Available
MLLSRHRERLAANLQETAKDAGERWELSAPTFTRHCPKTARMAHPFIGVVHRINSYSSVLETYCTRHHPATPTSANPDVGTPRPSEDNVPAKPRLLESLS
TYLQMRCVREDAHVSTADQLVEYQAARKTHDSLHACSVYRELQAFLVNLSSFLNGCYVPGVHWLEPFQQQLVMHTFFFLVSIKAPQKTHQLFGLFKQYFG
LFETPNSVLQTFKQKASVFLIPRRHGKTWIVVAIISMLLASVENINIGYVAHQKHVANSVFAEIIKTLCRWFPPKNLNIKKENGTIIYTRPGGRSSSLMC
ATCFNKNSIRGQTFNLLYVDEANFIKKDALPAILGFMLQKDAKLIFISSVNSSDRSTSFLLNLRNAQEKMLNVVSYVCADHREDFHLQDALVSCPCYRLH
IPTYITIDESIKTTTNLFMEGAFDTELMGEGAASSNATLYRVVGDAALTQFDMCRVDTTAQQVQKCLGKQLFVYIDPAYTNNTEASGTGVGAVVTSTQTP
TRSLILGMEHFFLRDLTGAAAYEIASCACTMIKAIAVLHPTIERVNAAVEGNSSQDSGVAIATVLNEICPLPIHFLHYTDKSSALQWPIYMLGGEKSSAF
ETFIYALNSGTLSASQTVVSNTIKISFDPVTYLVEQVRAIKCVPLRDGGQSYSAKQKHMSDDLLVAVVMAHFMATDDRHMYKPISPQ
687
Not Available
Not Available
28-06-2011
Inferred from homology
Amino Acid Count % Frequency Amino Acid Count % Frequency
Alanine (A) Leucine (L)
Arginine (R) Lysine (K)
Asparagine (N) Methionine (M)
Aspartic Acid (D) Phenylalanine (F)
Cysteine (C) Proline (P)
Glutamine (Q) Serine (S)
Glutamic Acid (E) Threonine (T)
Glycine (G) Tryptophan (W)
Histidine (H) Tyrosine (Y)
Isoleucine (I) Valine (V)
% Number of Residues in Helices % Number of Residues in Strands % Number of Residues in Coils
Component of the molecular motor that translocates viral genomic DNA in empty capsid during DNA packaging. Forms a tripartite terminase complex together with TRM1 and TRM2 in the host cytoplasm. Once the complex reaches the host nucleus, it interacts with the capsid portal vertex. This portal forms a ring in which genomic DNA is translocated into the capsid. TRM3 carries an RNase H-like nuclease activity that plays an important role for the cleavage of concatemeric viral DNA into unit length genomes.
3.1.-.-  
GO:0003677  ;   GO:0006323  ;   GO:0016787  ;   GO:0042025  
Host nucleus . Note=Responsible for the nuclear localization of the two others subunits TRM1 and TRM2. .
Not Available
MOTIF 221 228 Walker A motif. ; MOTIF 316 321 Walker B motif.
Predicted/Modelled
Not Available
♦ACT_SITE 321 321 For ATPase activity.
♦ ACT_SITE 476 476 For nuclease activity.
♦ ACT_SITE 550 550 For nuclease activity.
♦ ACT_SITE 662 662 For nuclease activity.
Protein couldn't be modeled using I-Tasser and Raptor X because of length constraints of the software.
Not Available
Virtual screening has been performed using RASPD
  • Million Molecules

Best 20 Hit molecules

    Not Available