viHumans
Reviewed
Homo Sapiens (Human) [TaxID: 9606]
UL117[Gene ID: 3077511 ]
Protein UL117 (pUL117)
Human Cytomegalovirus (strain Merlin) (HHV-5) (Human Herpesvirus 5)
Viruses> DsDNA Viruses> No RNA Stage> Herpesvirales> Herpesviridae> Betaherpesvirinae> Cytomegalovirus> Human Cytomegalovirus (HHV-5) (Human Herpesvirus 5)> Human Cytomegalovirus (strain Merlin) (HHV-5) (Human Herpesvirus 5)
Not Available
Various pathway(s) in which protein is involved
Not Available
MVMFSQDHVQIVYGSTRICKSLAPANKRKTHRTIVVAPRRGFLRIPPDGQDVNHVKIVPTTTSSSLAPPRDDERRPTPPLRPPLTVYPYGTSLIRRSARD
AKLRSKLIVFHITRPALGQHPQNPGISGPAAMDHSEFLTSFRREVDRQTVLTAESAPATVEVCLGDALPGGVMGGGGLPAGVGSASAAVAAAAAAVAGVP
VAANPVMPATATVTTPPMIDLTSHHRPLTLFTPASAAAAPAVATNGGNATYILPADCRYAPLFASKYKYVFEEVSRLMRLHDSTAVQLQISASCGNAFQA
LKSALLKLHNVTVLAGQQLITQTMPHTPQAVATFKFFHQDPNRVLDCIRPVVPRSTSYHETGVYQMWVSGATKKDLFDAVTLCASIVEKQPDVFNINVSL
LTYPSIAAPHLPLYNEFTSFRLPTS
425
VAR_SEQ 1 131 Missing (in isoform UL1175)
Not Available
28-06-2011
Inferred from homology
Amino Acid Count % Frequency Amino Acid Count % Frequency
Alanine (A) Leucine (L)
Arginine (R) Lysine (K)
Asparagine (N) Methionine (M)
Aspartic Acid (D) Phenylalanine (F)
Cysteine (C) Proline (P)
Glutamine (Q) Serine (S)
Glutamic Acid (E) Threonine (T)
Glycine (G) Tryptophan (W)
Histidine (H) Tyrosine (Y)
Isoleucine (I) Valine (V)
% Number of Residues in Helices % Number of Residues in Strands % Number of Residues in Coils
Plays a role in the inhibition of host DNA replication in the infected cell. Targets the mini-chromosome maintenance (MCM) complex and blocks the accumulation of MCM proteins and their loading onto host chromatin (By similarity).
Not Available
♦ Isoform UL117: Host nucleus . Note=The major fraction localizes to nuclear compartments. .
♦ Isoform UL117.5: Host nucleus .
Not Available
Not Available
Predicted/Modelled
Not Available
Not Available
Protein couldn't be modeled using I-Tasser and Raptor X because of length constraints of the software.
Not Available
Virtual screening has been performed using RASPD
  • Million Molecules

Best 20 Hit molecules

    Not Available