viHumans
Reviewed
Homo Sapiens (Human) [TaxID: 9606]
K7[Gene ID: 4961500 ]
Protein K7
Human Herpesvirus 8 Type P (isolate GK18) (HHV-8) (Kaposi's Sarcoma-associated Herpesvirus)
Viruses> DsDNA Viruses> No RNA Stage> Herpesvirales> Herpesviridae> Gammaherpesvirinae> Rhadinovirus> Human Herpesvirus 8 (HHV-8) (Kaposi's Sarcoma-associated Herpesvirus)> Human Herpesvirus 8 Type P (isolate GK18) (HHV-8) (Kaposi's Sarcoma-associated Herpesvirus)
Various pathway(s) in which protein is involved
Not Available
MGTLEIKGASLSQFSTGTAQSPWLPLHLWILCSLLAFLPLLVFIGAADCGLIASLLAIYPSWLSARFSVLLFPHWPESCSTKNTARSGALHKPAEQKLRF
AQKPCHGNYTVTPCGLLHWIQSPGQL
126
Not Available
Not Available
28-06-2011
Evidence at protein level
Amino Acid Count % Frequency Amino Acid Count % Frequency
Alanine (A) Leucine (L)
Arginine (R) Lysine (K)
Asparagine (N) Methionine (M)
Aspartic Acid (D) Phenylalanine (F)
Cysteine (C) Proline (P)
Glutamine (Q) Serine (S)
Glutamic Acid (E) Threonine (T)
Glycine (G) Tryptophan (W)
Histidine (H) Tyrosine (Y)
Isoleucine (I) Valine (V)
% Number of Residues in Helices % Number of Residues in Strands % Number of Residues in Coils
Plays a role in the inhibition of host apoptosis to allow completion of the viral lytic replication and may thus favor the maintenance of persistent infection in infected host.
Not Available
GO:0016021  ;   GO:0033644  ;   GO:0033650  ;   GO:0039526  
♦ Host membrane
♦ Single-pass membrane protein . Host mitochondrion .
Not Available
Not Available
Predicted/Modelled
Not Available
Not Available
Protein couldn't be modeled using I-Tasser and Raptor X because of length constraints of the software.
Not Available
Virtual screening has been performed using RASPD
  • Million Molecules

Best 20 Hit molecules

    Not Available