viHumans
Reviewed
Homo Sapiens (Human) [TaxID: 9606]
UL82[Gene ID: 3077530 ]
Protein pp71
Human Cytomegalovirus (strain Merlin) (HHV-5) (Human Herpesvirus 5)
Viruses> DsDNA Viruses> No RNA Stage> Herpesvirales> Herpesviridae> Betaherpesvirinae> Cytomegalovirus> Human Cytomegalovirus (HHV-5) (Human Herpesvirus 5)> Human Cytomegalovirus (strain Merlin) (HHV-5) (Human Herpesvirus 5)
Not Available
Various pathway(s) in which protein is involved
Not Available
MSQASSSPGEGPSSEAAAISEAEAASGSFGRLHCQVLRLITNVEGGSLEAGRLRLLDLRTNIEVSRPSVLCCFQENKSPHDTVDLTDLNIKGRCVVGEQD
RLLVDLNNFGPRRLTPGSENNTVSVLAFALPLDRVPVSGLHLFQSQRRGGEENRPRMEARAIIRRTAHHWAVRLTVTPNWRRRTDSSLEAGQIFVSQFAF
RAGAIPLTLVDALEQLACSDPNTYIHKTETDERGQWIMLFLHHDSPHPPTSVFLHFSVYTHRAEVVARHNPYPHLRRLPDNGFQLLIPKSFTLTRIHPEY
IVQIQNAFETNQTHDTIFFPENIPGVSIEAGPLPDRVRITLRVTLTGDQAVHLEHRQPLGRIHFFRRGFWTLTPGKPDKIKRPQVQLRAGLFPRSNVMRG
AVSEFLPQSPGLPPTEEEEEEEEEDDEDDLSSTPTPTPLSEAMFAGFEEASGDEDSDTQAGLSRALILTGQRRRSGNNGALTLVIPSWHVFASLDDLVPL
TVSVQHAALRPTSYLRSDMDGDVRTAADISSTLRSVPAPRPSPISTASTSSTPRSRPRI
559
Not Available
Not Available
28-06-2011
Inferred from homology
Amino Acid Count % Frequency Amino Acid Count % Frequency
Alanine (A) Leucine (L)
Arginine (R) Lysine (K)
Asparagine (N) Methionine (M)
Aspartic Acid (D) Phenylalanine (F)
Cysteine (C) Proline (P)
Glutamine (Q) Serine (S)
Glutamic Acid (E) Threonine (T)
Glycine (G) Tryptophan (W)
Histidine (H) Tyrosine (Y)
Isoleucine (I) Valine (V)
% Number of Residues in Helices % Number of Residues in Strands % Number of Residues in Coils
Stimulates viral immediate-early (IE) transcription. Counteracts the DAXX-mediated repression of viral transcription. Displaces a DAXX-binding protein, ATRX, from nuclear domain 10 sites (ND10) shortly after infection. Increases the basal level of SUMOylated DAXX in infected cells. May also play a role in the progression of the host cell cycle through the G1 phase (By similarity).
Not Available
GO:0009405  ;   GO:0019033  ;   GO:0039645  ;   GO:0039695  ;   GO:0042025  
Virion tegument . Host nucleus . Note=Present in the nucleus shortly after infection as well as during the late phase of viral morphogenesis. Detected at nuclear domain 10 (ND10).
Not Available
Not Available
Predicted/Modelled
Not Available
Not Available
Protein couldn't be modeled using I-Tasser and Raptor X because of length constraints of the software.
Not Available
Virtual screening has been performed using RASPD
  • Million Molecules

Best 20 Hit molecules

    Not Available