viHumans
Reviewed
Homo Sapiens (Human) [TaxID: 9606]
UL84[Gene ID: 3077525 ]
Protein UL84
Human Cytomegalovirus (strain Merlin) (HHV-5) (Human Herpesvirus 5)
Viruses> DsDNA Viruses> No RNA Stage> Herpesvirales> Herpesviridae> Betaherpesvirinae> Cytomegalovirus> Human Cytomegalovirus (HHV-5) (Human Herpesvirus 5)> Human Cytomegalovirus (strain Merlin) (HHV-5) (Human Herpesvirus 5)
Not Available
Various pathway(s) in which protein is involved
Not Available
MPRVDPNLRNRARRPRARRGGGGGVGSNSSRHSGKCRRQRRALSTPPLTFLATTTTTTMMGVASTDDDSLLLKTPDELDKHSGSPQTILTLTDKHDIRQP
RVHRGTYHLIQLHLDLRPEELRDPFQILLSTPLQLGEANGESQTAPATSQEEETAASHEPEKKKEKEEKKEEEDEDDRNDDRERGILCVVSNEDSDVRPA
FSLFPARPGCHILRSVIDQQLTRMAIVRLSLNLFALRIITPLLKRLPLRRKAAHHTALHDCLALHLPELTFEPTLDINNVTENAASVADTAESTDADLTP
TLTVRVRHALCWHRVEGGISGPRGLTSRISARLSETTAKTLGPSVFGRLELDPNESPPDLTLSSLTLYQDGILRFNVTCDRTEAPADPVAFRLRLRRETV
RRPFFSDAPLPYFVPPRSGAADEGLEVRVPYELTLKNSHTLRIYRRFYGPYLGVFVPHNRQGLKMPVTVWLPRSWLELTVLVSDENGATFPRDALLGRLY
FISSKHTLNRGCLSAMTHQVKSTLHSRSTSHSPSQQQLSVLGASIALEDLLPMRLASPETEPQDCKLTENTTEKTSPVTLAMVCGDL
587
Not Available
Not Available
28-06-2011
Inferred from homology
Amino Acid Count % Frequency Amino Acid Count % Frequency
Alanine (A) Leucine (L)
Arginine (R) Lysine (K)
Asparagine (N) Methionine (M)
Aspartic Acid (D) Phenylalanine (F)
Cysteine (C) Proline (P)
Glutamine (Q) Serine (S)
Glutamic Acid (E) Threonine (T)
Glycine (G) Tryptophan (W)
Histidine (H) Tyrosine (Y)
Isoleucine (I) Valine (V)
% Number of Residues in Helices % Number of Residues in Strands % Number of Residues in Coils
Plays an essential role in viral DNA replication. May participate in the DNA replication initiation by interacting with the origin of lytic replication, oriLyt and subsequently recruiting other viral/cellular factors. Additionally, interacts with and shuttles IRS1 viral mRNA from the host nucleus to the cytoplasm (By similarity).
Not Available
Host nucleus . Host cytoplasm . Note=Shuttles between host nucleus and cytoplasm. In the nucleus, colocalizes with UL44 and IE2 in the viral DNA replication compartments (By similarity). .
Not Available
MOTIF 161 170 Nuclear localization signal. ; MOTIF 229 238 Nuclear export signal 1 (NES 1). ; MOTIF 360 367 Nuclear export signal 2 (NES 2).
Predicted/Modelled
Not Available
Not Available
Protein couldn't be modeled using I-Tasser and Raptor X because of length constraints of the software.
Not Available
Virtual screening has been performed using RASPD
  • Million Molecules

Best 20 Hit molecules

    Not Available