viHumans
Reviewed
Homo Sapiens (Human) [TaxID: 9606]
UL135[Gene ID: 3077458 ]
Protein UL135
Human Cytomegalovirus (strain Merlin) (HHV-5) (Human Herpesvirus 5)
Viruses> DsDNA Viruses> No RNA Stage> Herpesvirales> Herpesviridae> Betaherpesvirinae> Cytomegalovirus> Human Cytomegalovirus (HHV-5) (Human Herpesvirus 5)> Human Cytomegalovirus (strain Merlin) (HHV-5) (Human Herpesvirus 5)
Not Available
Various pathway(s) in which protein is involved
Not Available
MVWLWLGVGLLGGTGLASLVLAISLFTQRRGRKRSDETSSRGRLPGAASDKRGACACCYRIPKEDVVEPLDLELGLMRVATHPPTPQVPRCTSLYIGEDG
LPIDKPEFPPARFEIPDVSTPGTPTSIGRSPSHCSSSSSLSSSASVDTVLHQPPPSWKPPPPPGRKKRPPTPPVRAPTTRLSSHRPPTPIPAPRKNLSTP
PTKKTPPPTKPKPVGWTPPVTPRPFPKTPTPQKPPRNPRLPRTVGLENLSKVGLSCPCPRPRTPTEPTTLPIVSVSELAPPPRWSDIEELLEKAVQSVMK
DAESMQMT
308
Not Available
Not Available
28-06-2011
Evidence at protein level
Amino Acid Count % Frequency Amino Acid Count % Frequency
Alanine (A) Leucine (L)
Arginine (R) Lysine (K)
Asparagine (N) Methionine (M)
Aspartic Acid (D) Phenylalanine (F)
Cysteine (C) Proline (P)
Glutamine (Q) Serine (S)
Glutamic Acid (E) Threonine (T)
Glycine (G) Tryptophan (W)
Histidine (H) Tyrosine (Y)
Isoleucine (I) Valine (V)
% Number of Residues in Helices % Number of Residues in Strands % Number of Residues in Coils
Remodels the host actin cytoskeleton in order to impair immune recognition of infected cells. Mechanistically, interacts with members of the host WAVE2 complex and redirects the complex to the plasma membrane. In turn, the efficiency of immune synapse formation is greatly reduced.
Not Available
GO:0016020  ;   GO:0020002  ;   GO:0039671  ;   GO:0044177  
Host cell membrane . Host Golgi apparatus .
Not Available
Not Available
Predicted/Modelled
Not Available
Not Available
Protein couldn't be modeled using I-Tasser and Raptor X because of length constraints of the software.
Not Available
Virtual screening has been performed using RASPD
  • Million Molecules

Best 20 Hit molecules

    Not Available