viHumans
Reviewed
Homo Sapiens (Human) [TaxID: 9606]
ORF55[Gene ID: 4961432 ]
Tegument protein ORF55
Human Herpesvirus 8 Type P (isolate GK18) (HHV-8) (Kaposi's Sarcoma-associated Herpesvirus)
Viruses> DsDNA Viruses> No RNA Stage> Herpesvirales> Herpesviridae> Gammaherpesvirinae> Rhadinovirus> Human Herpesvirus 8 (HHV-8) (Kaposi's Sarcoma-associated Herpesvirus)> Human Herpesvirus 8 Type P (isolate GK18) (HHV-8) (Kaposi's Sarcoma-associated Herpesvirus)
Various pathway(s) in which protein is involved
Not Available
MSSPWYTWTCCGINLFGRGNHAYKRLGDPLEGCPERWRQEIDLGLPPGVCLGDVVQSNLGTTALHQTYLLAVQSNKITDYLKRFDVAKIPAGCQETVKTQ
VKKLQSIQNVVWNTMLALAVGEITVDDSALQSLLNKRAGECVSLMEMEKLATAMASDDSVIWASEISHSLSEPTSVLPLTPAVTRQPEATLPKPPTEDPS
VSAMHSSIPPRPSSTLEETTESAIGST
227
Not Available
Not Available
28-06-2011
Inferred from homology
Amino Acid Count % Frequency Amino Acid Count % Frequency
Alanine (A) Leucine (L)
Arginine (R) Lysine (K)
Asparagine (N) Methionine (M)
Aspartic Acid (D) Phenylalanine (F)
Cysteine (C) Proline (P)
Glutamine (Q) Serine (S)
Glutamic Acid (E) Threonine (T)
Glycine (G) Tryptophan (W)
Histidine (H) Tyrosine (Y)
Isoleucine (I) Valine (V)
% Number of Residues in Helices % Number of Residues in Strands % Number of Residues in Coils
Plays several roles during the time course of infection, including egress of virus particles from the perinuclear space and secondary envelopment of cytoplasmic capsids that bud into specific trans-Golgi network (TGN)-derived membranes.
Not Available
Virion tegument . Host cytoplasm . Host Golgi apparatus .
Not Available
Not Available
Predicted/Modelled
Not Available
Not Available
Protein couldn't be modeled using I-Tasser and Raptor X because of length constraints of the software.
Not Available
Virtual screening has been performed using RASPD
  • Million Molecules

Best 20 Hit molecules

    Not Available