viHumans
Reviewed
Homo Sapiens (Human) [TaxID: 9606]
US3
Membrane glycoprotein US3
Human Cytomegalovirus (strain Towne) (HHV-5) (Human Herpesvirus 5)
Viruses> DsDNA Viruses> No RNA Stage> Herpesvirales> Herpesviridae> Betaherpesvirinae> Cytomegalovirus> Human Cytomegalovirus (HHV-5) (Human Herpesvirus 5)> Human Cytomegalovirus (strain Towne) (HHV-5) (Human Herpesvirus 5)
Not Available
Various pathway(s) in which protein is involved
Not Available
Not Available
MKPVLVLAILAVLFLRLADSVPRPLDVVVSEIRSAHFRVEENQCWFHMGMLHYKGRMSGNFTEKHFVSVGIVSQSYMDRLQVSGEQYHHDERGAYFEWNI
GGHPVPHTVDMVDITLSTRWGDPKKYAACVPQVRMDYSSQTINWYLQRSIRDDNWGLLFRTLLVYLFSLVVLVLLTVGVSARLRFI
186
Not Available
Not Available
19-10-2011
Evidence at protein level
Amino Acid Count % Frequency Amino Acid Count % Frequency
Alanine (A) Leucine (L)
Arginine (R) Lysine (K)
Asparagine (N) Methionine (M)
Aspartic Acid (D) Phenylalanine (F)
Cysteine (C) Proline (P)
Glutamine (Q) Serine (S)
Glutamic Acid (E) Threonine (T)
Glycine (G) Tryptophan (W)
Histidine (H) Tyrosine (Y)
Isoleucine (I) Valine (V)
% Number of Residues in Helices % Number of Residues in Strands % Number of Residues in Coils
Retains, but does not degrade MHC class I heterodimers in the endoplasmic reticulum during the immediate-early period of virus infection, thereby impairing their transport and maturation. Forms a complex with beta-2-microglobulin-associated class I heavy chains, which accumulate in the ER. In consequence, infected cells are masked for immune recognition by cytotoxic T-lymphocytes.
Not Available
GO:0005537  ;   GO:0016021  ;   GO:0030683  ;   GO:0044167  
♦ Host endoplasmic reticulum membrane
♦ Single-pass type I membrane protein.
Not Available
Not Available
Predicted/Modelled
Not Available
Not Available
Protein couldn't be modeled using I-Tasser and Raptor X because of length constraints of the software.
Not Available
Virtual screening has been performed using RASPD
  • Million Molecules

Best 20 Hit molecules

    Not Available