viHumans
Reviewed
Homo Sapiens (Human) [TaxID: 9606]
Not Available
Non-structural protein 6 (NSP6)
Rotavirus A (strain RVA/Human/Philippines/L26/1987/G12P1B[4]) (RV-A)
Viruses> DsRNA Viruses> Reoviridae> Sedoreovirinae> Rotavirus> Rotavirus A> Rotavirus A Isolates> Rotavirus A (strain RVA/Human/Philippines/L26/1987/G12P1B[4]) (RV-A)
Various pathway(s) in which protein is involved
Not Available
Not Available
MNRLLQRQLFLENLLVGVNSTFHQMQKHSINTCCRSLQRILDHLILLQTIHSPAFRLDRMQLRQMQTLACLWIHRRNHDLQATLDVINWISP
92
Not Available
Not Available
02-09-2008
Inferred from homology
Amino Acid Count % Frequency Amino Acid Count % Frequency
Alanine (A) Leucine (L)
Arginine (R) Lysine (K)
Asparagine (N) Methionine (M)
Aspartic Acid (D) Phenylalanine (F)
Cysteine (C) Proline (P)
Glutamine (Q) Serine (S)
Glutamic Acid (E) Threonine (T)
Glycine (G) Tryptophan (W)
Histidine (H) Tyrosine (Y)
Isoleucine (I) Valine (V)
% Number of Residues in Helices % Number of Residues in Strands % Number of Residues in Coils
Not Available
Not Available
Host cytoplasm . Host mitochondrion . Note=Found in spherical cytoplasmic structures, called viral factories, that appear early after infection and are the site of viral replication and packaging. .
Not Available
Not Available
Predicted/Modelled
Not Available
Not Available
Protein couldn't be modeled using I-Tasser and Raptor X because of length constraints of the software.
Not Available
Virtual screening has been performed using RASPD
  • Million Molecules

Best 20 Hit molecules

    Not Available