viHumans
Reviewed
Homo Sapiens (Human) [TaxID: 9606]
Not Available
Non-structural protein 2 (NSP2) (EC 3.6.4.-) (NCVP3) (Non-structural RNA-binding protein 35) (NS35)
Rotavirus A (isolate RVA/Human/United Kingdom/A64/1987/G10P11[14]) (RV-A)
Viruses> DsRNA Viruses> Reoviridae> Sedoreovirinae> Rotavirus> Rotavirus A> Rotavirus G10> Rotavirus G10P11> Rotavirus A (isolate RVA/Human/United Kingdom/A64/1987/G10P11[14]) (RV-A)
Various pathway(s) in which protein is involved
Not Available
Not Available
MAELACFCYPHLENDSYKFIPFNSLAIKCMLTAKVDKKDQDKFYNSIIYGIAPPPQFKKRYNTNDNSRGMNYETPMFNKVAVLICEALNSIKVTQSDVAS
VLSRVVSVRHLENLVLRRENHQDVLFHSKELLLKSVLIAIGHSKEIETTATAEGGEIVFQNAAFTMWRLTYLEHKLMPILDQNFIEYKITVNEDKPVSES
HVKELIAELRWQYNKFAVITHGKGHYRVVKYSSVANHADRVYATFKSNNKNGNMLEFNLLDQRIIWQNWYAFTSSMKQGNTLDVCKRLLFQKMKRESNPF
KGLSTDRKMDEVSQVGI
317
Not Available
Not Available
02-09-2008
Inferred from homology
Amino Acid Count % Frequency Amino Acid Count % Frequency
Alanine (A) Leucine (L)
Arginine (R) Lysine (K)
Asparagine (N) Methionine (M)
Aspartic Acid (D) Phenylalanine (F)
Cysteine (C) Proline (P)
Glutamine (Q) Serine (S)
Glutamic Acid (E) Threonine (T)
Glycine (G) Tryptophan (W)
Histidine (H) Tyrosine (Y)
Isoleucine (I) Valine (V)
% Number of Residues in Helices % Number of Residues in Strands % Number of Residues in Coils
Participates in replication and packaging of the viral genome. Plays a crucial role, together with NSP5, in the formation of virus factories (viroplasms) which are large inclusions in the host cytoplasm where replication intermediates are assembled and viral RNA replication takes place. Displays ssRNA binding, NTPase, RNA triphosphatase (RTPase) and ATP-independent helix-unwinding activities. The unwinding activity may prepare and organize plus-strand RNAs for packaging and replication by removing interfering secondary structures. The RTPase activity plays a role in the removal of the gamma-phosphate from the rotavirus RNA minus strands of dsRNA genome segments.
3.6.4.-  
GO:0003723  ;   GO:0005524  ;   GO:0016817  ;   GO:0019079  ;   GO:0030430  ;  
GO:0046872  
Host cytoplasm . Note=Found in spherical cytoplasmic structures, called viral factories, that appear early after infection and are the site of viral replication and packaging. .
Not Available
Not Available
Predicted/Modelled
Not Available
ACT_SITE 225 225 For NTPase and RTPase activities.
Protein couldn't be modeled using I-Tasser and Raptor X because of length constraints of the software.
Not Available
Virtual screening has been performed using RASPD
  • Million Molecules

Best 20 Hit molecules

    Not Available