Reviewed
Homo Sapiens (Human) [TaxID: 9606]
GPC GP-C[Gene ID: 6216304 ]
♦Pre-glycoprotein polyprotein GP complex (Pre-GP-C) [Cleaved into: Stable signal peptide (SSP)
♦ Glycoprotein G1 (GP1)
♦ Glycoprotein G2 (GP2)]
♦ Glycoprotein G1 (GP1)
♦ Glycoprotein G2 (GP2)]
Chapare Mammarenavirus (isolate Human/Bolivia/810419/2003)
Viruses> SsRNA Viruses> SsRNA Negative-strand Viruses> Arenaviridae> Mammarenavirus> Chapare Mammarenavirus (isolate Human/Bolivia/810419/2003)
Various pathway(s) in which protein is involved
Not Available
MGQLVSFFQEIPNIIQEAINIALIAVSLIAILKGLVNLWKSGLFQLLVFLILAGRSCSFKIGRSTELQNITINMLKVFEDHPISCTVNKTLYYIRESENA
TWCVEIAALDMSVLLSPHDPRVMGNLSNCVHPDIKHRSELLGLLEWILRALKYDFLNYPPLLCEKVTSSVNETRIQINVSDSAGSHDFKETMLQRLAILF
GTKLMFDKTPKQFIVIRNQTWVNQCKSNHVNTLHLMMANAGHAVKLRRLQGVFTWTITDAAGNDMPGGYCLERWMLVTSDLKCFGNTALAKCNLNHDSEF
CDMLKLFEFNKKAIESLNDNTKNKVNLLTHSINALISDNLLMKNRLKELLDTPYCNYTKFWYVNHTITGEHSLPRCWMVKNNSYLNESEFRNDWILESDH
LLSEMLNKEYFDRQGKTPITLVDICFWSTLFFTTTLFLHLVGFPTHRHIQGEPCPLPHKLNSNGGCRCGRYPELKKPTTWHRKH
TWCVEIAALDMSVLLSPHDPRVMGNLSNCVHPDIKHRSELLGLLEWILRALKYDFLNYPPLLCEKVTSSVNETRIQINVSDSAGSHDFKETMLQRLAILF
GTKLMFDKTPKQFIVIRNQTWVNQCKSNHVNTLHLMMANAGHAVKLRRLQGVFTWTITDAAGNDMPGGYCLERWMLVTSDLKCFGNTALAKCNLNHDSEF
CDMLKLFEFNKKAIESLNDNTKNKVNLLTHSINALISDNLLMKNRLKELLDTPYCNYTKFWYVNHTITGEHSLPRCWMVKNNSYLNESEFRNDWILESDH
LLSEMLNKEYFDRQGKTPITLVDICFWSTLFFTTTLFLHLVGFPTHRHIQGEPCPLPHKLNSNGGCRCGRYPELKKPTTWHRKH
484
Not Available
Not Available
20-05-2008
Inferred from homology
Amino Acid | Count | % Frequency | Amino Acid | Count | % Frequency |
---|---|---|---|---|---|
Alanine (A) | Leucine (L) | ||||
Arginine (R) | Lysine (K) | ||||
Asparagine (N) | Methionine (M) | ||||
Aspartic Acid (D) | Phenylalanine (F) | ||||
Cysteine (C) | Proline (P) | ||||
Glutamine (Q) | Serine (S) | ||||
Glutamic Acid (E) | Threonine (T) | ||||
Glycine (G) | Tryptophan (W) | ||||
Histidine (H) | Tyrosine (Y) | ||||
Isoleucine (I) | Valine (V) |
% Number of Residues in Helices | % Number of Residues in Strands | % Number of Residues in Coils |
---|---|---|
♦Glycoprotein G2: class I viral fusion protein that directs fusion of viral and host endosomal membranes, leading to delivery of the nucleocapsid into the cytoplasm. Membrane fusion is mediated by irreversible conformational changes induced upon acidification in the endosome.
♦ Stable signal peptide (SSP): cleaved and functions as a signal peptide. In addition, it is also retained as the third component of the GP complex. The SSP is required for efficient glycoprotein expression, post-translational maturation cleavage of GP1 and GP2, glycoprotein transport to the cell surface plasma membrane, formation of infectious virus particles, and acid pH-dependent glycoprotein-mediated cell fusion.
♦ Glycoprotein G1: interacts with the host receptor.
♦ Stable signal peptide (SSP): cleaved and functions as a signal peptide. In addition, it is also retained as the third component of the GP complex. The SSP is required for efficient glycoprotein expression, post-translational maturation cleavage of GP1 and GP2, glycoprotein transport to the cell surface plasma membrane, formation of infectious virus particles, and acid pH-dependent glycoprotein-mediated cell fusion.
♦ Glycoprotein G1: interacts with the host receptor.
Not Available
GO:0016021 ; GO:0019031 ; GO:0019062 ; GO:0020002 ; GO:0039654 ;
GO:0044167 ; GO:0044178 ; GO:0046872 ; GO:0055036 ; GO:0075509
GO:0044167 ; GO:0044178 ; GO:0046872 ; GO:0055036 ; GO:0075509
♦ Glycoprotein G1: Virion membrane
♦ Peripheral membrane protein . Host endoplasmic reticulum membrane
♦ Peripheral membrane protein . Host Golgi apparatus membrane
♦ Peripheral membrane protein . Host cell membrane
♦ Peripheral membrane protein .
♦ Glycoprotein G2: Virion membrane
♦ Single-pass membrane protein . Host endoplasmic reticulum membrane
♦ Single-pass membrane protein . Host Golgi apparatus membrane
♦ Single-pass membrane protein . Host cell membrane
♦ Single-pass membrane protein . Note=Binding to the stable signal peptide masks endogenous ER localization signals in the cytoplasmic domain of G2 to ensure that only the fully assembled, tripartite GP complex is transported for virion assembly. .
♦ Stable signal peptide: Virion membrane
♦ Multi-pass membrane protein . Host endoplasmic reticulum membrane
♦ Multi-pass membrane protein . Host Golgi apparatus membrane
♦ Multi-pass membrane protein . Host cell membrane
♦ Multi-pass membrane protein .
♦ Peripheral membrane protein . Host endoplasmic reticulum membrane
♦ Peripheral membrane protein . Host Golgi apparatus membrane
♦ Peripheral membrane protein . Host cell membrane
♦ Peripheral membrane protein .
♦ Glycoprotein G2: Virion membrane
♦ Single-pass membrane protein . Host endoplasmic reticulum membrane
♦ Single-pass membrane protein . Host Golgi apparatus membrane
♦ Single-pass membrane protein . Host cell membrane
♦ Single-pass membrane protein . Note=Binding to the stable signal peptide masks endogenous ER localization signals in the cytoplasmic domain of G2 to ensure that only the fully assembled, tripartite GP complex is transported for virion assembly. .
♦ Stable signal peptide: Virion membrane
♦ Multi-pass membrane protein . Host endoplasmic reticulum membrane
♦ Multi-pass membrane protein . Host Golgi apparatus membrane
♦ Multi-pass membrane protein . Host cell membrane
♦ Multi-pass membrane protein .
Not Available
Not Available
Predicted/Modelled
Not Available
Not Available
Protein couldn't be modeled using I-Tasser and Raptor X because of length constraints of the software.
Not Available
- Million Molecules
Best 20 Hit molecules
Not Available