viHumans
Reviewed
Homo Sapiens (Human) [TaxID: 9606]
Not Available
♦Protein VP3 [Includes: 2',5'-phosphodiesterase (EC 3.1.4.-)
♦ mRNA guanylyltransferase (EC 2.7.7.50)
♦ mRNA (guanine-N(7)-)-methyltransferase (EC 2.1.1.56)]
Rotavirus A (strain RVA/Human/United Kingdom/ST3/1975/G4P2A[6]) (RV-A) (Rotavirus A (strain St. Thomas 3))
Viruses> DsRNA Viruses> Reoviridae> Sedoreovirinae> Rotavirus> Rotavirus A> Rotavirus G4> Rotavirus A (strain RVA/Human/United Kingdom/ST3/1975/G4P2A[6]) (RV-A) (Rotavirus A (strain St. Thomas 3))
Various pathway(s) in which protein is involved
Not Available
Not Available
MKVLALRHSVAQVYADTQIYLHDDSKDEYENAFLISNLTTHNILYLNYSLKTLKILNKSGIAAVEVQSPDELFALIRCNFTYDYENNIIYLHDYSYYTNN
EIRTDQHWITKTDIIDYLLPGWKLTYVGYNGKNTRGHYNFSFSCQNAATDDDIIIEYIYSNELDFQNFLLRKIKERMTTSLPIARLSNRVFRDKLFPSIV
NIYKKVINVGPRNESMFTFLNFPTIKQFSNGAYIVKHTIKLKQEKWLGKRVSQFDIGQYKNMLNVVTTIYYYYNLYHSKPIIYMLGSAPSHWIHDIKQYS
DFTFETWDPLDTPYSTIHHKELFFYKDVNKLKDNSILYIDIRTDRKNMDWKEWRKVVEQQTVNNLNIAYKYLSTGKAKVCCVKLTAMDLELPITAKLLHH
PTTEVRSEFYAILDVWDIITIKRFIPKGVFYAFINNITTENVFIQPPFKLKASPTDYIVALYALSNDFNSRQDVINLINKQKQSLITVRMNNTFKDEPKV
NFKNIYDWTFLPTDFELKDSIITSYDGCLGMFGLSISLSSKPTGNNHLFIINGNDKYYKLDQYANHMGISRRSHQIRFSESATSYSGYIFRDLSNNNFNL
IGTNVENSVSGHVYNALIYYRYNYAFDLKRWIYLHSIGKVAIEGGRYYEHAPIELIYACRSAREFAILQDDLTVLRYADEIEGYINKVYSITYADDPNYF
IGIKFNSIPYEYDVKVPHLTLGVLFISDNMIHNVVTVLKKMKTELFKTEISTSYTYMLSDNIYVANASGVLSTYFKLYNMFYRNHITFGQSRMFIPHITL
SFSTKQTVRIESTRLKINSIYLRKIKGETVFDMSE
835
Not Available
Not Available
29-04-2008
Inferred from homology
Amino Acid Count % Frequency Amino Acid Count % Frequency
Alanine (A) Leucine (L)
Arginine (R) Lysine (K)
Asparagine (N) Methionine (M)
Aspartic Acid (D) Phenylalanine (F)
Cysteine (C) Proline (P)
Glutamine (Q) Serine (S)
Glutamic Acid (E) Threonine (T)
Glycine (G) Tryptophan (W)
Histidine (H) Tyrosine (Y)
Isoleucine (I) Valine (V)
% Number of Residues in Helices % Number of Residues in Strands % Number of Residues in Coils
♦Multifunctional enzyme involved in mRNA capping. Catalyzes the formation of the 5' cap structure on the viral plus-strand transcripts. Specifically binds to GTP and displays guanylyltransferase and methyltransferase activities. Has affinity for ssRNA but not for dsRNA. Capping activity is non-specific and caps RNAs that initiate with either a G or an A residue. Together with VP1 polymerase, forms a VP1-VP3 complex positioned near the channels situated at each of the five-fold vertices of the core. Following infection, the outermost layer of the virus is lost, leaving a double-layered particle (DLP) made up of the core and VP6 shell. VP1 then catalyzes the transcription of fully conservative plus-strand genomic RNAs that are capped by VP3 and extruded through the DLP's channels into the cytoplasm where they function as mRNAs for translation of viral proteins. DLPs probably have an RNA triphosphatase activity as well, whereas open cores do not.
♦ Counteracts the host innate immune response thanks to its phosphodiesterase that degrades the 5'-triphosphorylated, 2'-5' linked adenylate oligomers produced by the host cell IFN-inducible 2',5'-oligoadenylate synthetase (OAS). The host RNaseL is therefore not activated.
3.1.4.-  ,   2.7.7.50  ,   2.1.1.56  
GO:0003723  ;   GO:0004482  ;   GO:0004484  ;   GO:0005525  ;   GO:0016032  ;  
GO:0019013  
Virion . Note=Attached inside the inner capsid as a minor component. There are about 11 to 12 copies per virion. .
Not Available
Not Available
Predicted/Modelled
Not Available
♦ACT_SITE 718 718 For 2'-5'-phosphodiesterase activity.
♦ ACT_SITE 720 720 For 2'-5'-phosphodiesterase activity.
♦ ACT_SITE 797 797 For 2'-5'-phosphodiesterase activity.
♦ ACT_SITE 799 799 For 2'-5'-phosphodiesterase activity.
Protein couldn't be modeled using I-Tasser and Raptor X because of length constraints of the software.
Not Available
Virtual screening has been performed using RASPD
  • Million Molecules

Best 20 Hit molecules

    Not Available