Reviewed
Homo Sapiens (Human) [TaxID: 9606]
Not Available
Large T antigen (LT) (LT-AG) (EC 3.6.4.-)
WU Polyomavirus (WUPyV)
Viruses> DsDNA Viruses> No RNA Stage> Polyomaviridae> Betapolyomavirus> Human Polyomavirus 4> WU Polyomavirus (WUPyV)
Various pathway(s) in which protein is involved
Not Available
MDKTLSRNEAKELMQLLGLDMTCWGNLPLMRTKYLSKCKEFHPDKGGNEEKMKKLNSLYLKLQECVSTVHQLNEEEDEVWSSSQIPTYGTPDWDYWWSQF
NSYWEEELRCNEEMPKSPGETPTKRTREDDEEPQCSQATPPKKKKDNATDASLSFPKELEEFVSQAVFSNRTLTAFVIHTTKEKAETLYKKLLSKFKCNF
ASRHSYYNTALVFILTPFRHRVSAVNNFCKGYCTISFLFCKGVNNAYGLYSRMTRDPFTLCEENIPGGLKENDFKAEDLYGEFKDQLNWKALSEFALELG
IDDVYLLLGLYLQLSIKVEECEKCNSNEDATHNRLHMEHQKNALLFSDSKSQKNVCQQAIDVVIAKRRVDSLNMSREDLLARRFEKILDKMDKTIKGEQD
VLLYMAGVAWYLGLNGKIDELVYRYLKVIVENVPKKRYWVFKGPINSGKTTVAAALLDLCGGKALNINIPADRLNFELGVAIDQFTVVFEDVKGQVGDNK
LLPSGNGMSNLDNLRDYLDGSVKVNLEKKHLNKRSQIFPPGIVTMNEYLVPATLAPRFHKTVLFTPKRHLKESLDKTPELMVKRVLQSGMCILLMLIWCR
PVSDFHPCIQAKVVYWKELLDKYIGLTEFADMQMNVTNGCNILEKHNA
NSYWEEELRCNEEMPKSPGETPTKRTREDDEEPQCSQATPPKKKKDNATDASLSFPKELEEFVSQAVFSNRTLTAFVIHTTKEKAETLYKKLLSKFKCNF
ASRHSYYNTALVFILTPFRHRVSAVNNFCKGYCTISFLFCKGVNNAYGLYSRMTRDPFTLCEENIPGGLKENDFKAEDLYGEFKDQLNWKALSEFALELG
IDDVYLLLGLYLQLSIKVEECEKCNSNEDATHNRLHMEHQKNALLFSDSKSQKNVCQQAIDVVIAKRRVDSLNMSREDLLARRFEKILDKMDKTIKGEQD
VLLYMAGVAWYLGLNGKIDELVYRYLKVIVENVPKKRYWVFKGPINSGKTTVAAALLDLCGGKALNINIPADRLNFELGVAIDQFTVVFEDVKGQVGDNK
LLPSGNGMSNLDNLRDYLDGSVKVNLEKKHLNKRSQIFPPGIVTMNEYLVPATLAPRFHKTVLFTPKRHLKESLDKTPELMVKRVLQSGMCILLMLIWCR
PVSDFHPCIQAKVVYWKELLDKYIGLTEFADMQMNVTNGCNILEKHNA
648
Not Available
Not Available
10-07-2007
Inferred from homology
Amino Acid | Count | % Frequency | Amino Acid | Count | % Frequency |
---|---|---|---|---|---|
Alanine (A) | Leucine (L) | ||||
Arginine (R) | Lysine (K) | ||||
Asparagine (N) | Methionine (M) | ||||
Aspartic Acid (D) | Phenylalanine (F) | ||||
Cysteine (C) | Proline (P) | ||||
Glutamine (Q) | Serine (S) | ||||
Glutamic Acid (E) | Threonine (T) | ||||
Glycine (G) | Tryptophan (W) | ||||
Histidine (H) | Tyrosine (Y) | ||||
Isoleucine (I) | Valine (V) |
% Number of Residues in Helices | % Number of Residues in Strands | % Number of Residues in Coils |
---|---|---|
Isoform large T antigen is a key early protein essential for both driving viral replication and inducing cellular transformation. Plays a role in viral genome replication by driving entry of quiescent cells into the cell cycle and by autoregulating the synthesis of viral early mRNA. Displays highly oncogenic activities by corrupting the host cellular checkpoint mechanisms that guard cell division and the transcription, replication, and repair of DNA. Participates in the modulation of cellular gene expression preceeding viral DNA replication. This step involves binding to host key cell cycle regulators retinoblastoma protein RB1/pRb and TP53. Induces the disassembly of host E2F1 transcription factors from RB1, thus promoting transcriptional activation of E2F1-regulated S-phase genes. Inhibits host TP53 binding to DNA, abrogating the ability of TP53 to stimulate gene expression. Plays the role of a TFIID-associated factor (TAF) in transcription initiation for all three RNA polymerases, by stabilizing the TBP-TFIIA complex on promoters. Initiates viral DNA replication and unwinding via interactions with the viral origin of replication. Binds two adjacent sites in the SV40 origin. The replication fork movement is facilitated by Large T antigen helicase activity. Activates the transcription of viral late mRNA, through host TBP and TFIIA stabilization. Interferes with histone deacetylation mediated by HDAC1, leading to activation of transcription.
3.6.4.-
GO:0003688 ; GO:0005524 ; GO:0006260 ; GO:0016787 ; GO:0039502 ;
GO:0039576 ; GO:0039645 ; GO:0042025 ; GO:0046872
GO:0039576 ; GO:0039645 ; GO:0042025 ; GO:0046872
Host nucleus .
♦DOMAIN 12 89 J.
♦ DOMAIN 417 579 SF3 helicase.
♦ DOMAIN 417 579 SF3 helicase.
MOTIF 108 112 LXCXE motif. ; MOTIF 140 147 Nuclear localization signal.
Predicted/Modelled
Not Available
Not Available
Protein couldn't be modeled using I-Tasser and Raptor X because of length constraints of the software.
Not Available
- Million Molecules
Best 20 Hit molecules
Not Available