viHumans
Reviewed
Aves [TaxID: 8782]; Homo Sapiens (Human) [TaxID: 9606]; Sus Scrofa (Pig) [TaxID: 9823]
PB1 PB1-F2
Protein PB1-F2
Influenza A Virus (strain A/Malaysia:Malaya/302/1954 H1N1)
Viruses> SsRNA Viruses> SsRNA Negative-strand Viruses> Orthomyxoviridae> Alphainfluenzavirus> Influenza A Virus> H1N1 Subtype> Influenza A Virus (strain A/Malaysia:Malaya/302/1954 H1N1)
Not Available
 
Various pathway(s) in which protein is involved
Not Available
Not Available
MGQEQGTPWILSTGHISTQKGEDGQKTPKLEHHNSTQLMGHYQKTMNQVVMPKQIVY
57
Not Available
Not Available
01-05-2007
Inferred from homology
Amino Acid Count % Frequency Amino Acid Count % Frequency
Alanine (A) Leucine (L)
Arginine (R) Lysine (K)
Asparagine (N) Methionine (M)
Aspartic Acid (D) Phenylalanine (F)
Cysteine (C) Proline (P)
Glutamine (Q) Serine (S)
Glutamic Acid (E) Threonine (T)
Glycine (G) Tryptophan (W)
Histidine (H) Tyrosine (Y)
Isoleucine (I) Valine (V)
% Number of Residues in Helices % Number of Residues in Strands % Number of Residues in Coils
May play an important role in promoting lung pathology in both primary viral infection and secondary bacterial infection.
Not Available
Host nucleus . Host cytoplasm, host cytosol .
Not Available
Not Available
Predicted/Modelled
Not Available
Not Available
Protein couldn't be modeled using I-Tasser and Raptor X because of length constraints of the software.
Not Available
Virtual screening has been performed using RASPD
  • Million Molecules

Best 20 Hit molecules

    Not Available