Reviewed
Homo Sapiens (Human) [TaxID: 9606]; Mammalia [TaxID: 40674]
P
Phosphoprotein (Protein P) (Protein M1)
Rabies Virus (strain India) (RABV)
Viruses> SsRNA Viruses> SsRNA Negative-strand Viruses> Mononegavirales> Rhabdoviridae> Lyssavirus> Rabies Lyssavirus> Rabies Virus (strain India) (RABV)
Various pathway(s) in which protein is involved
Not Available
Not Available
MSKIFVNPSAIRAGLADLEMAEETVDLINKNIEDNQAHLQGEPIEVDNLPEDMRRLHLDDEKPSGLGGMAKAGEVKYREDFQMDEGEDPNLLFQSYLDNV
GVQIVRQMRSGERFLKIWSQTVEEIISYVTVNFPNPPGRSSEDKSTQTTGRELKKETTSASYQRDSQSSKARMAAQTASGPPALEWSATNEEDDLSVEAE
IAHQIAESFSKKHKFPSRSSGIFLYNFEQLKMNLDDIVKEAKNVPGVTRLAHDGSKLPLRCVLGWVGLANSKKFQLLVEPDKLNKIMQDDLNRYTSS
GVQIVRQMRSGERFLKIWSQTVEEIISYVTVNFPNPPGRSSEDKSTQTTGRELKKETTSASYQRDSQSSKARMAAQTASGPPALEWSATNEEDDLSVEAE
IAHQIAESFSKKHKFPSRSSGIFLYNFEQLKMNLDDIVKEAKNVPGVTRLAHDGSKLPLRCVLGWVGLANSKKFQLLVEPDKLNKIMQDDLNRYTSS
297
VAR_SEQ 1 82 Missing (in isoform P5) ; VAR_SEQ 1 68 Missing (in isoform P4) ; VAR_SEQ 1 52 Missing (in isoform P3) ; VAR_SEQ 1 19 Missing (in isoform P2)
Not Available
03-04-2007
Inferred from homology
Amino Acid | Count | % Frequency | Amino Acid | Count | % Frequency |
---|---|---|---|---|---|
Alanine (A) | Leucine (L) | ||||
Arginine (R) | Lysine (K) | ||||
Asparagine (N) | Methionine (M) | ||||
Aspartic Acid (D) | Phenylalanine (F) | ||||
Cysteine (C) | Proline (P) | ||||
Glutamine (Q) | Serine (S) | ||||
Glutamic Acid (E) | Threonine (T) | ||||
Glycine (G) | Tryptophan (W) | ||||
Histidine (H) | Tyrosine (Y) | ||||
Isoleucine (I) | Valine (V) |
% Number of Residues in Helices | % Number of Residues in Strands | % Number of Residues in Coils |
---|---|---|
Non catalytic polymerase cofactor and regulatory protein that plays a role in viral transcription and replication. Stabilizes the RNA polymerase L to the N-RNA template and binds the soluble protein N, preventing it from encapsidating non-genomic RNA. Also inhibits host IFN-alpha and IFN-beta signaling by binding and retaining phosphorylated STAT1 in the cytoplasm or by inhibiting the DNA binding of STAT1 in the nucleus. Might be involved, through interaction with host dynein, in intracellular microtubule-dependent virus transport of incoming virus from the synapse toward the cell body (By similarity).
Not Available
GO:0003968 ; GO:0019012 ; GO:0019083 ; GO:0030430 ; GO:0039502 ;
GO:0039563 ; GO:0039564 ; GO:0042025 ; GO:0046718 ; GO:0075521
GO:0039563 ; GO:0039564 ; GO:0042025 ; GO:0046718 ; GO:0075521
♦ Phosphoprotein: Virion. Host cytoplasm .
♦ Isoform P2: Host cytoplasm .
♦ Isoform P3: Host nucleus .
♦ Isoform P4: Host nucleus .
♦ Isoform P5: Host nucleus .
♦ Isoform P2: Host cytoplasm .
♦ Isoform P3: Host nucleus .
♦ Isoform P4: Host nucleus .
♦ Isoform P5: Host nucleus .
Not Available
MOTIF 49 58 Nuclear export signal. ; MOTIF 211 214 Nuclear localization signal.
Predicted/Modelled
Not Available
Not Available
Protein couldn't be modeled using I-Tasser and Raptor X because of length constraints of the software.
Not Available
- Million Molecules
Best 20 Hit molecules
Not Available