Reviewed
Homo Sapiens (Human) [TaxID: 9606]
Not Available
Non-structural protein 5 (NSP5) (NS26)
Rotavirus A (strain RVA/Human/Philippines/L26/1987/G12P1B[4]) (RV-A)
Viruses> DsRNA Viruses> Reoviridae> Sedoreovirinae> Rotavirus> Rotavirus A> Rotavirus A Isolates> Rotavirus A (strain RVA/Human/Philippines/L26/1987/G12P1B[4]) (RV-A)
NC_011500.2 ; NC_011501.2 ; NC_011502.2 ; NC_011503.2 ; NC_011504.2 ; NC_011505.2 ; NC_011506.2 ;
NC_011507.2 ; NC_011508.2 ; NC_011509.2 ; NC_011510.2 ; NC_011511.2
NC_011507.2 ; NC_011508.2 ; NC_011509.2 ; NC_011510.2 ; NC_011511.2
Various pathway(s) in which protein is involved
Not Available
Not Available
MSLSIDVTSLPSISSSIFKNESSSTTSTLSGKSIGRSEQYISPDAEAFNKYMLSKSPEDIGPSDSASNDPLTSFSIRSNAVKTNADAGVSMDSSTQSRSS
SNVGCDQLDFSLTKGINVNANLESCISISTDHKKEKSKKDKSRKHYPRIEADSDSEDYILDDSDSDDGKCKNCKYKKKYFALRMRMKRVAMQLIEDL
SNVGCDQLDFSLTKGINVNANLESCISISTDHKKEKSKKDKSRKHYPRIEADSDSEDYILDDSDSDDGKCKNCKYKKKYFALRMRMKRVAMQLIEDL
197
Not Available
Not Available
20-03-2007
Inferred from homology
Amino Acid | Count | % Frequency | Amino Acid | Count | % Frequency |
---|---|---|---|---|---|
Alanine (A) | Leucine (L) | ||||
Arginine (R) | Lysine (K) | ||||
Asparagine (N) | Methionine (M) | ||||
Aspartic Acid (D) | Phenylalanine (F) | ||||
Cysteine (C) | Proline (P) | ||||
Glutamine (Q) | Serine (S) | ||||
Glutamic Acid (E) | Threonine (T) | ||||
Glycine (G) | Tryptophan (W) | ||||
Histidine (H) | Tyrosine (Y) | ||||
Isoleucine (I) | Valine (V) |
% Number of Residues in Helices | % Number of Residues in Strands | % Number of Residues in Coils |
---|---|---|
Plays an essential role in the viral genome replication. Participates, together with NSP2, in the formation of viral factories (viroplasms) which are large inclusions in the host cytoplasm where replication intermediates are assembled and viral RNA replication takes place. Orchestrates the recruitment of viroplasmic proteins such as capsid proteins to these factories.
Not Available
Host cytoplasm . Note=Found in spherical cytoplasmic structures, called virus factories, that appear early after infection and are the site of viral replication and packaging. .
Not Available
Not Available
Predicted/Modelled
Not Available
Not Available
Protein couldn't be modeled using I-Tasser and Raptor X because of length constraints of the software.
Not Available
- Million Molecules
Best 20 Hit molecules
Not Available