Reviewed
Homo Sapiens (Human) [TaxID: 9606]; Macaca Fascicularis (Crab-eating Macaque) (Cynomolgus Monkey) [TaxID: 9541]; Pteropodinae [TaxID: 77225]; Sus Scrofa (Pig) [TaxID: 9823]
VP24
Membrane-associated protein VP24
Reston Ebolavirus (strain Philippines-96) (REBOV) (Reston Ebola Virus)
Viruses> SsRNA Viruses> SsRNA Negative-strand Viruses> Mononegavirales> Filoviridae> Ebolavirus> Reston Ebolavirus> Reston Ebolavirus (strain Philippines-96) (REBOV) (Reston Ebola Virus)
Not Available
Various pathway(s) in which protein is involved
Not Available
Not Available
MAKATGRYNLVPPKKDMEKGVIFSDLCNFLITQTLQGWKVYWAGIEFDVSQKGMALLTRLKTNDFAPAWAMTRNLFPHLFQNPNSVIQSPIWALRVILAA
GLQDQLLDHSLVEPLTGALGLISDWLLTTTSTHFNLRTRSVKDQLSLRMLSLIRSNILQFINKLDALHVVNYNGLLSSIEIGTSTHTIIITRTNMGFLVE
VQEPDKSAMNSKRPGPVKFSLLHESAFKPFTRVPQSGMQSLIMEFNSLLAI
GLQDQLLDHSLVEPLTGALGLISDWLLTTTSTHFNLRTRSVKDQLSLRMLSLIRSNILQFINKLDALHVVNYNGLLSSIEIGTSTHTIIITRTNMGFLVE
VQEPDKSAMNSKRPGPVKFSLLHESAFKPFTRVPQSGMQSLIMEFNSLLAI
251
Not Available
Not Available
01-12-2001
Evidence at protein level
| Amino Acid | Count | % Frequency | Amino Acid | Count | % Frequency |
|---|---|---|---|---|---|
| Alanine (A) | Leucine (L) | ||||
| Arginine (R) | Lysine (K) | ||||
| Asparagine (N) | Methionine (M) | ||||
| Aspartic Acid (D) | Phenylalanine (F) | ||||
| Cysteine (C) | Proline (P) | ||||
| Glutamine (Q) | Serine (S) | ||||
| Glutamic Acid (E) | Threonine (T) | ||||
| Glycine (G) | Tryptophan (W) | ||||
| Histidine (H) | Tyrosine (Y) | ||||
| Isoleucine (I) | Valine (V) |
| % Number of Residues in Helices | % Number of Residues in Strands | % Number of Residues in Coils |
|---|---|---|
Prevents the establishment of cellular antiviral state by blocking the interferon-alpha/beta (IFN-alpha/beta) and IFN-gamma signaling pathways. Blocks the IFN-induced nuclear accumulation of host phosphorylated STAT1, by interacting with the STAT1-binding region of host importin alpha-1/KPNA1 protein, thereby inhibiting the latter. Without the activity of this protein, activated STAT1 would not enter the nucleus and be unable to activate IFN-induced genes. Plays a role in assembly of viral nucleocapsid and virion budding. May act as a minor matrix protein that plays a role in assembly of viral nucleocapsid and virion budding.
Not Available
♦ Virion membrane
♦ Peripheral membrane protein . Host cell membrane
♦ Peripheral membrane protein
♦ Cytoplasmic side . Host endomembrane system
♦ Peripheral membrane protein . Note=In virion, localizes on the intravirional side of the membrane. In the host cell, it is found associated with virus-induced membrane proliferation foci and to the plasma membrane where budding takes place (By similarity). .
♦ Peripheral membrane protein . Host cell membrane
♦ Peripheral membrane protein
♦ Cytoplasmic side . Host endomembrane system
♦ Peripheral membrane protein . Note=In virion, localizes on the intravirional side of the membrane. In the host cell, it is found associated with virus-induced membrane proliferation foci and to the plasma membrane where budding takes place (By similarity). .
Not Available
Not Available
X-ray crystallography (1)
Not Available
Protein couldn't be modeled using I-Tasser and Raptor X because of length constraints of the software.
Not Available
- Million Molecules
Best 20 Hit molecules
Not Available