Reviewed
Capra Hircus (Goat) [TaxID: 9925]; Homo Sapiens (Human) [TaxID: 9606]; Ovis Aries (Sheep) [TaxID: 9940]
A3R
Protein F9 homolog (Fragment)
Orf Virus (strain NZ2) (OV NZ-2)
Viruses> DsDNA Viruses> No RNA Stage> Poxviridae> Chordopoxvirinae> Parapoxvirus> Orf Virus (ORFV)> Orf Virus (strain NZ2) (OV NZ-2)
Various pathway(s) in which protein is involved
Not Available
Not Available
GHAAANCALARVATALTRRVPASRHGLAEGGTPPWTLLLAVAAVTVLGVVAVSLLRRALRVRYRFARPAALRA
73
Not Available
Not Available
01-10-1996
Inferred from homology
| Amino Acid | Count | % Frequency | Amino Acid | Count | % Frequency |
|---|---|---|---|---|---|
| Alanine (A) | Leucine (L) | ||||
| Arginine (R) | Lysine (K) | ||||
| Asparagine (N) | Methionine (M) | ||||
| Aspartic Acid (D) | Phenylalanine (F) | ||||
| Cysteine (C) | Proline (P) | ||||
| Glutamine (Q) | Serine (S) | ||||
| Glutamic Acid (E) | Threonine (T) | ||||
| Glycine (G) | Tryptophan (W) | ||||
| Histidine (H) | Tyrosine (Y) | ||||
| Isoleucine (I) | Valine (V) |
| % Number of Residues in Helices | % Number of Residues in Strands | % Number of Residues in Coils |
|---|---|---|
Not Available
Not Available
♦ Virion membrane
♦ Single-pass membrane protein . Note=Component of the mature virion (MV) membrane. The mature virion is located in the cytoplasm of infected cells and is probably released by cell lysis (By similarity). .
♦ Single-pass membrane protein . Note=Component of the mature virion (MV) membrane. The mature virion is located in the cytoplasm of infected cells and is probably released by cell lysis (By similarity). .
Not Available
Not Available
Predicted/Modelled
Not Available
Not Available
Protein couldn't be modeled using I-Tasser and Raptor X because of length constraints of the software.
Not Available
- Million Molecules
Best 20 Hit molecules
Not Available